KEGG   Shewanella amazonensis: Sama_2133Help
Entry
Sama_2133         CDS       T00445                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
saz  Shewanella amazonensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sama_2133
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sama_2133
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sama_2133
Enzymes [BR:saz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sama_2133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2578783..2579976
Genome map
AA seq 397 aa AA seqDB search
MSELKLDPYFGEYGGMYVPQILMPALKQLETAFVEAQQDPEFLTEFHDLLKNYAGRPTAL
TLTRNLSPNPKVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVAT
ALACALLGLKCKVYMGAKDVARQSPNVFRMRLMGAEVIPVTSGSATLKDACNEAMRDWSG
SYDRAHYLLGTAAGPHPFPTIVREFQRMIGAETKAQMLEKEGRLPDAVIACVGGGSNAIG
MFADFIDEPSVKLIGVEPAGKGIDTPMHGAPLKHGKTGIFFGMKAPLMQDAHGQIEESYS
ISAGLDFPSVGPQHAYLNATGRATYESATDDEALEAFQLLARSEGIIPALESAHALAYAL
RLAKDATEEQIIVVNLSGRGDKDIFTVSDILDGKASA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagctgaaactcgatccctacttcggcgaatacggcggtatgtacgtgccgcaa
attctgatgccggcgctgaagcaactggagaccgcctttgttgaggcccagcaagaccca
gagttcttaacagaattccacgacctgttgaaaaactatgcgggccgccccaccgcctta
accttgacccgtaatctgtctcccaatcccaaggtgaaaatctacttaaagcgtgaggac
ctgctgcacggcggtgcccacaagaccaatcaggtgctaggtcaggcgctgcttgccaaa
cgcatgggcaagaaagagattattgccgagacaggcgccgggcaacacggtgtggccaca
gcgctggcttgcgccctgttggggctcaagtgcaaggtatacatgggtgccaaagacgta
gcccgccagagccccaatgtgtttcgtatgcgtttgatgggcgcggaggttatcccggtc
acctccggctctgccaccctcaaggatgcctgtaacgaggccatgcgtgactggtccggc
agctacgaccgcgcccactatttgctgggtactgccgcagggcctcatcccttccccacc
atagtacgggaattccagcgcatgattggcgccgaaacaaaagcccaaatgttggagaaa
gaaggccgcctgccggatgccgttatcgcctgcgtgggtggcggctccaacgccatcggt
atgtttgctgactttatcgacgaaccttcggtgaagcttattggggtagagcccgctggc
aagggcattgacacaccgatgcacggtgcgccgctcaagcatggcaagacgggtatcttc
tttggtatgaaagcccccttgatgcaggatgcgcatggccagattgaagagtcctactcg
atttctgccggtctggacttcccgtccgttggaccccagcacgcctatctcaatgccacc
ggccgcgccacctatgagtcggccaccgatgacgaagcgctggaggcattccagctgctt
gcccgcagcgaaggcattatcccggcactggaatcggctcacgcgctggcgtatgcactg
cgtctggccaaagacgccaccgaagagcaaatcattgtggtcaatctctctggccgcggt
gataaagacatttttaccgtatctgacattttagacggcaaggccagcgcataa

DBGET integrated database retrieval system