KEGG   Shewanella amazonensis: Sama_2134Help
Entry
Sama_2134         CDS       T00445                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
saz  Shewanella amazonensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sama_2134
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sama_2134
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sama_2134
Enzymes [BR:saz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sama_2134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2579988..2580788
Genome map
AA seq 266 aa AA seqDB search
MNRYSNAFARLKAGSRGAFVPFVTLGDPGIDESLAIIDALVEGGADCLELGFPFSDPLAD
GPVIQGANIRALAAGTTPDTCFKMIEQIRAKYPELPIGLLLYANLVFANGIEAFYQRAKA
AGVDSVLIADVPAEESAPFVAAARAEGIAPIFIAPPNASADTLRLVASLGEGYTYLLSRA
GVTGADNKAGMPLDSVLSALKEFNAPPPLLGFGIAEPSQVQEAIAAGAAGAISGSAVVKR
IEALKDDMPKLLTELKSFASAMKAAT
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgatattcgaacgcctttgcccgcttaaaagccggatcacggggcgccttcgtg
cctttcgtcaccctgggtgacccaggcatcgacgagagtctcgcgattattgatgccctg
gttgaaggcggcgccgattgtcttgagctgggctttcccttctcagacccactcgccgat
ggcccggtgatccagggcgccaatatccgcgccttggccgccggaacaaccccggatacc
tgtttcaagatgattgagcaaatccgcgccaagtatcccgaactgcccattggcctcttg
ctgtacgccaatttggtatttgccaatggcatagaagccttctaccaacgcgccaaggct
gccggggtcgattctgtgctgattgccgatgtgccggcagaagagtcagcgcctttcgtt
gccgccgccagggccgaaggcatagcgccgatttttatcgcgcccccaaatgccagcgcc
gacaccctgcgactggtcgcgtcccttggggaaggttacacctacctcttgtcccgcgcc
ggagtgacaggcgccgacaacaaagccggtatgccactggactcggtactatcggccctg
aaggaattcaacgcgcctccaccgctgctgggatttggcattgccgaaccttcacaggtt
caggaagcgattgctgccggggcagccggtgccatttccggctccgcggtagtcaagcgt
atcgaagccttaaaggacgatatgcccaagctcctgactgaactcaagtcctttgccagc
gccatgaaggcagccacctga

DBGET integrated database retrieval system