KEGG   Shewanella amazonensis: Sama_2223Help
Entry
Sama_2223         CDS       T00445                                 

Definition
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
saz  Shewanella amazonensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sama_2223
   00052 Galactose metabolism
    Sama_2223
   00500 Starch and sucrose metabolism
    Sama_2223
   00520 Amino sugar and nucleotide sugar metabolism
    Sama_2223
Enzymes [BR:saz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sama_2223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2686957..2687865
Genome map
AA seq 302 aa AA seqDB search
MRQTKIRKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVSEAVAAGIKEIVLVTH
ASKNSIENHFDTSFELEAQLERRVKRQLLDEVQAICPKDVTVISVRQAQAKGLGHAILCA
RPVVGDEPFAVLLPDVIIDGAKSDLTSENLAAMVRLFDETSTGQIMVEAVPHEMVNQYGI
ADVKGHQMVNGDSVPLEALVEKPAVDEAPSNLAVVGRYVLPADIWPLLARTPAGAGDEIQ
LTDAIAMLMESAQVNAYGMVGKSHDCGNKQGYMQANVEYALRHPELGKEFAKYLKQLVKG
LN
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagacaaaccaaaatccgtaaggccgtgatccctgttgccggtctgggtacccggatg
ctccctgccaccaaagccatccccaaggagatgctgccggtcgtggataagccactcatc
cagtatgtggtcagcgaagccgtggcggccgggattaaggaaattgtcctggtaacccac
gccagtaaaaactccatcgaaaaccatttcgacaccagttttgagctcgaagcccaactg
gaacgccgggttaagcgccagttattggatgaagttcaggccatctgtcccaaagatgtt
accgtgataagcgtacgccaggcacaggccaagggcctgggtcatgccatcctgtgcgcc
cgcccggtggtgggggacgagccctttgcagtgctcctgcccgacgtgataatcgacggc
gccaagagtgacctgaccagtgaaaacctcgctgccatggtgagactcttcgatgaaacc
agcaccggccaaatcatggtggaagccgtaccccatgagatggtgaatcaatatggcatt
gccgacgttaaaggccaccagatggtgaatggcgactccgtgccactggaggccttggta
gaaaagccagcggtagacgaagccccgtccaacctcgctgtggtcggtcgctacgtactg
cctgcagatatctggcctttactggcacgcacccctgccggagccggcgatgaaattcag
ctgaccgatgccatcgccatgttgatggaatccgctcaggtcaatgcctacggcatggtg
ggtaaaagccatgactgtggcaacaagcagggttatatgcaggccaatgtggaatacgcg
ctgcgtcaccccgagcttggtaaggaatttgccaagtatttgaagcaactggttaaagga
ctcaactaa

DBGET integrated database retrieval system