KEGG   Shewanella amazonensis: Sama_2223Help
Entry
Sama_2223         CDS       T00445                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
saz  Shewanella amazonensis
Pathway
saz00040  Pentose and glucuronate interconversions
saz00052  Galactose metabolism
saz00500  Starch and sucrose metabolism
saz00520  Amino sugar and nucleotide sugar metabolism
saz01100  Metabolic pathways
saz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sama_2223
   00052 Galactose metabolism
    Sama_2223
   00500 Starch and sucrose metabolism
    Sama_2223
   00520 Amino sugar and nucleotide sugar metabolism
    Sama_2223
Enzymes [BR:saz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sama_2223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABM00429
JGI: Sama2223
UniProt: A1S7S2
Position
2686957..2687865
Genome map
AA seq 302 aa AA seqDB search
MRQTKIRKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVSEAVAAGIKEIVLVTH
ASKNSIENHFDTSFELEAQLERRVKRQLLDEVQAICPKDVTVISVRQAQAKGLGHAILCA
RPVVGDEPFAVLLPDVIIDGAKSDLTSENLAAMVRLFDETSTGQIMVEAVPHEMVNQYGI
ADVKGHQMVNGDSVPLEALVEKPAVDEAPSNLAVVGRYVLPADIWPLLARTPAGAGDEIQ
LTDAIAMLMESAQVNAYGMVGKSHDCGNKQGYMQANVEYALRHPELGKEFAKYLKQLVKG
LN
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagacaaaccaaaatccgtaaggccgtgatccctgttgccggtctgggtacccggatg
ctccctgccaccaaagccatccccaaggagatgctgccggtcgtggataagccactcatc
cagtatgtggtcagcgaagccgtggcggccgggattaaggaaattgtcctggtaacccac
gccagtaaaaactccatcgaaaaccatttcgacaccagttttgagctcgaagcccaactg
gaacgccgggttaagcgccagttattggatgaagttcaggccatctgtcccaaagatgtt
accgtgataagcgtacgccaggcacaggccaagggcctgggtcatgccatcctgtgcgcc
cgcccggtggtgggggacgagccctttgcagtgctcctgcccgacgtgataatcgacggc
gccaagagtgacctgaccagtgaaaacctcgctgccatggtgagactcttcgatgaaacc
agcaccggccaaatcatggtggaagccgtaccccatgagatggtgaatcaatatggcatt
gccgacgttaaaggccaccagatggtgaatggcgactccgtgccactggaggccttggta
gaaaagccagcggtagacgaagccccgtccaacctcgctgtggtcggtcgctacgtactg
cctgcagatatctggcctttactggcacgcacccctgccggagccggcgatgaaattcag
ctgaccgatgccatcgccatgttgatggaatccgctcaggtcaatgcctacggcatggtg
ggtaaaagccatgactgtggcaacaagcagggttatatgcaggccaatgtggaatacgcg
ctgcgtcaccccgagcttggtaaggaatttgccaagtatttgaagcaactggttaaagga
ctcaactaa

DBGET integrated database retrieval system