KEGG   Shewanella amazonensis: Sama_2232Help
Entry
Sama_2232         CDS       T00445                                 

Definition
cysQ protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
saz  Shewanella amazonensis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:saz00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2696411..2697256)
Genome map
AA seq 281 aa AA seqDB search
MAVFAWPEHHGPQVAGGYMTLVALDKTTLDKLGQIARQAGAAIMAVYGQGDVAVTQKSDD
SPVTAADLASHTVIIEQLAAAFPFTPVLSEEAVIDWETRRQWQEYFLIDPLDGTKEFIKR
NGEFTVNIALVRDGIAVAGVVFAPVLDTCYLGAEGLGAWLECQGKQQPLQGSAQKRDVPV
VVGSRSHQSAEMAGYLADLGDHELLSVGSSLKFCMLAEGRADLYPRLGPTSEWDTAAAQA
VLESAGGRVVVYGESNPLVYNKKEQLLNPWFMATAPGWNTH
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggcggtttttgcttggccagaacatcacggaccacaggttgcaggaggatatatgaca
ttggtggcattggataaaacgacactggataagctggggcagatagcccgtcaggctggt
gcggccataatggcagtgtacgggcagggtgacgtggccgtgactcagaaaagcgacgac
agcccggtgactgccgctgatttggccagccataccgtgataatcgagcagctcgctgcg
gcctttccgtttacaccggtgctgtcagaagaggccgttattgactgggaaacccgccgt
cagtggcaggagtacttccttatcgatcccctcgatggcaccaaggagtttatcaagcgc
aatggtgagtttaccgtcaatattgcgctggtgagagatggcattgccgtagccggtgtg
gtgtttgcccccgtcctggatacctgttatctcggagcagagggactgggcgcctggctc
gagtgtcagggaaagcagcaaccattgcagggtagtgcgcaaaaacgcgacgttcccgtg
gttgttggcagtcgctcacatcagtctgccgagatggcgggttatttggccgaccttggc
gaccatgagcttctcagtgtgggcagctcgcttaaattttgcatgcttgccgaagggcgg
gcagacctgtacccgcgtcttgggccaaccagcgagtgggacacggcagctgcccaggcg
gtgctggagagcgccgggggcagggtggtggtgtatggcgagtccaacccgctggtttac
aacaaaaaagaacagcttcttaacccttggtttatggcaactgccccggggtggaacact
cattaa

DBGET integrated database retrieval system