KEGG   Shewanella amazonensis: Sama_2232Help
Entry
Sama_2232         CDS       T00445                                 

Definition
cysQ protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
saz  Shewanella amazonensis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Sama_2232
Enzymes [BR:saz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Sama_2232
Transfer RNA biogenesis [BR:saz03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Sama_2232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2696411..2697256)
Genome map
AA seq 281 aa AA seqDB search
MAVFAWPEHHGPQVAGGYMTLVALDKTTLDKLGQIARQAGAAIMAVYGQGDVAVTQKSDD
SPVTAADLASHTVIIEQLAAAFPFTPVLSEEAVIDWETRRQWQEYFLIDPLDGTKEFIKR
NGEFTVNIALVRDGIAVAGVVFAPVLDTCYLGAEGLGAWLECQGKQQPLQGSAQKRDVPV
VVGSRSHQSAEMAGYLADLGDHELLSVGSSLKFCMLAEGRADLYPRLGPTSEWDTAAAQA
VLESAGGRVVVYGESNPLVYNKKEQLLNPWFMATAPGWNTH
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggcggtttttgcttggccagaacatcacggaccacaggttgcaggaggatatatgaca
ttggtggcattggataaaacgacactggataagctggggcagatagcccgtcaggctggt
gcggccataatggcagtgtacgggcagggtgacgtggccgtgactcagaaaagcgacgac
agcccggtgactgccgctgatttggccagccataccgtgataatcgagcagctcgctgcg
gcctttccgtttacaccggtgctgtcagaagaggccgttattgactgggaaacccgccgt
cagtggcaggagtacttccttatcgatcccctcgatggcaccaaggagtttatcaagcgc
aatggtgagtttaccgtcaatattgcgctggtgagagatggcattgccgtagccggtgtg
gtgtttgcccccgtcctggatacctgttatctcggagcagagggactgggcgcctggctc
gagtgtcagggaaagcagcaaccattgcagggtagtgcgcaaaaacgcgacgttcccgtg
gttgttggcagtcgctcacatcagtctgccgagatggcgggttatttggccgaccttggc
gaccatgagcttctcagtgtgggcagctcgcttaaattttgcatgcttgccgaagggcgg
gcagacctgtacccgcgtcttgggccaaccagcgagtgggacacggcagctgcccaggcg
gtgctggagagcgccgggggcagggtggtggtgtatggcgagtccaacccgctggtttac
aacaaaaaagaacagcttcttaacccttggtttatggcaactgccccggggtggaacact
cattaa

DBGET integrated database retrieval system