KEGG   Shewanella amazonensis: Sama_2380Help
Entry
Sama_2380         CDS       T00445                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
saz  Shewanella amazonensis
Pathway
saz00630  Glyoxylate and dicarboxylate metabolism
saz01100  Metabolic pathways
saz01110  Biosynthesis of secondary metabolites
saz01120  Microbial metabolism in diverse environments
saz01200  Carbon metabolism
Module
saz_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Sama_2380
Enzymes [BR:saz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Sama_2380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABM00585
JGI: Sama2380
UniProt: A1S878
Position
complement(2858428..2859747)
Genome map
AA seq 439 aa AA seqDB search
MSKYISRQEQIDALKKDWAENPRWKGVRRPYTAEEVVSLRGSFVPENTVAQRGAAKLWDL
VNGGAKKGYVNSLGALTGGQAVQQAKAGIEAIYLSGWQVAADANLAGTMYPDQSLYPANS
VPAVVGRINNSFRRADQIQWSNGVGPEDDKFVDYFLPIVADAEAGFGGVLNAYELMKSMI
DAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGVETLVIARTDAN
AADLLTSDCDPYDSDFITGERTSEGFYRVRAGLDQAIARGLAYAPYADLIWCETAKPDLE
EARRFAEAIHAKYPDQLLAYNCSPSFNWKKNLDDATIAKFQQALSDMGYKYQFITLAGIH
NMWFNMFDLAYDYARGEGMKHYVEKVQEAEFAAASKGYTFVAHQQEVGTGYFDKMTNIIQ
GGASSVTALTGSTEEEQFH
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagtacatcagccgccaggaacaaattgacgcactgaaaaaggactgggccgaa
aacccacgctggaaaggtgtgcgccgtccttatactgccgaagaagtggtttcgctgcgc
ggctcttttgtaccggagaatacagtggcccagcgcggcgcagccaaactgtgggacctg
gtcaacggtggtgccaaaaaaggttatgtaaactccctcggtgccctgaccggtggtcag
gcggtacagcaggccaaggccggcattgaagctatctatttgtctggctggcaggtagcc
gccgatgccaacctggccggtaccatgtacccagaccaatctctgtaccccgccaactct
gtgcctgctgtggttggtcgtatcaataactcattccgccgcgccgaccagatccaatgg
agcaacggcgtaggtccggaagatgacaagttcgttgattacttcctgccaatcgtggcg
gatgccgaagccggctttggtggtgtactcaatgcttacgagttgatgaagtctatgatt
gatgccggtgccgccggtgtgcactttgaagatcagctggcatcggtaaagaaatgcggt
cacatgggcggcaaagtgttggtgcccactcaggaagcggtacaaaaactggttgcggcc
cgtttggcggctgacgtatctggcgtagagactctggttattgcccgtaccgacgccaat
gctgccgatctgctgacctcggattgcgacccatacgacagcgacttcatcacaggtgag
cgtaccagcgaaggtttctaccgtgtccgtgccggtctggaccaggccatcgcccgtggt
ttggcttacgctccatacgccgacctcatctggtgtgaaactgccaagccggacctggaa
gaagcccgccgcttcgccgaggccatccatgccaagtacccggatcagctgctggcctat
aactgctcaccttctttcaactggaagaagaatctggacgacgccactatcgccaagttc
cagcaggccttgtctgacatgggctacaagtatcagttcatcaccctggccggtatccac
aatatgtggttcaacatgttcgacctggcgtacgactacgcccgcggtgaaggcatgaag
cactatgtagagaaggtgcaggaagccgagtttgctgccgccagtaagggatataccttt
gtggcgcaccagcaggaagtgggcaccggctacttcgacaagatgaccaatatcattcag
ggcggtgcctcttctgtgactgcactgaccggttccactgaggaagaacagttccactga

DBGET integrated database retrieval system