KEGG   Shewanella amazonensis: Sama_2381Help
Entry
Sama_2381         CDS       T00445                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
saz  Shewanella amazonensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:saz01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:saz00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:saz00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2859826..2861457)
Genome map
AA seq 543 aa AA seqDB search
MTEQMMEQPQTLTGLKLAGHHIQGQEEVFTEGAMSLLESLCARFAGDVDALLAKRKERQV
RIDKGELPDFLPETRAIRDGKWTIRGIPTDLQDRRVEITGPVDRKMIINALNADVKVFMA
DFEDSLAPSWEKVIQGQINLRDAVRGTIEYKAPDTGKEYRLNDNPAVLIARVRGLHLKEK
HVEFNGQSIPGALFDFCFYFYHNYRQLLSKGSGPYFYIPKLESHLEARWWAKVFAFTEER
FCLEPGTIKCTCLIETLPAVFEMDEILYELRSNIVALNCGRWDYIFSYIKTLKHHSDRVL
PDRQQVTMDKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPAKDAEANRLVLERVCKDKEL
EARNGHDGTWVAHPGLAQTAMAVFNQFIGDDHCNQLHITRDVDAPILASELLAPCEGERT
EHGMRLNIRIALQYIEAWISGNGCVPIYGLMEDAATAEISRASIWQWIHHQKHLSNGKLV
TKALLKEMLVEELANVKEEVGSERFTHGRFTQAAVLLEEITTADELVDFLTLPGYELLTK
QEH
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgacagagcaaatgatggagcagccacagacactgaccgggctcaagctggcgggtcat
catatccaggggcaggaagaagtctttactgaaggcgcaatgtcgctgcttgagtccctg
tgtgccaggtttgcaggcgacgtggatgccttactggctaaacgtaaagaacgccaggtt
cgcattgataaaggtgagttgccggatttcctgccggagacacgcgccatacgtgatggt
aagtggaccattcgtggcataccaaccgacttgcaggatcgccgggtggaaatcactggt
cccgtggaccgcaagatgatcatcaatgccctgaatgccgatgtgaaagtctttatggct
gactttgaggattcattggcacccagctgggaaaaggtgattcaggggcaaatcaacctg
cgtgatgcggtgcgtggcaccattgaatataaagcgcccgatacaggtaaagagtaccgc
ttgaacgataatccagcggtgctgattgccagggtgcgcggcttacacctcaaagaaaaa
cacgtggaatttaacggccaatcgatcccgggagccctgtttgatttctgtttctacttt
tatcacaactaccgtcagttactgagtaaaggcagtgggccgtacttttatatccccaag
ctcgagagccatctcgaggcgcgttggtgggccaaggtctttgcctttaccgaagagcgt
ttctgcctcgagccgggcacaatcaagtgtacctgtttgatagaaaccctgccggccgtg
tttgaaatggacgaaatcctctatgagctgcgctccaatatcgttgcgctcaactgtggt
cgatgggattacatcttcagctatatcaaaaccttgaaacaccacagtgatcgcgtactg
cctgacaggcaacaagtcaccatggataagccgttcctcagcgcctattcgcgtctgctg
atcaaaacttgtcacaagcggggagcccttgcgatgggcggtatggcggctttcattcca
gccaaagatgccgaagccaaccgcctggtgcttgaacgggtttgcaaagacaaggagctg
gaagcccgtaacggccatgacggcacctgggtcgcccatcccggtctggcacaaacggcg
atggccgtgtttaaccagtttatcggtgatgaccactgcaatcagctgcacatcacccgt
gatgtggatgcgccgattttggccagcgagctgctggcgccctgcgagggtgagcgcacc
gagcacggtatgcgactgaatattcgcattgcgctgcagtacatcgaggcctggatcagt
ggcaatggttgtgtgcccatttatggtctgatggaagatgccgccacggcggaaatctcc
cgcgcctccatctggcaatggatccatcatcagaagcacctatccaacggcaaacttgtg
accaaggcactgctgaaggaaatgctggtggaggagcttgccaacgtcaaagaagaagtg
ggcagcgagcgctttacccacggcagatttacccaagcggctgtgctgctggaggagatc
acgaccgccgacgagctggtcgacttcctgacactgccgggctacgagctgctgaccaaa
caagaacactga

DBGET integrated database retrieval system