KEGG   Shewanella amazonensis: Sama_2381Help
Entry
Sama_2381         CDS       T00445                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
saz  Shewanella amazonensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sama_2381
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sama_2381
   00630 Glyoxylate and dicarboxylate metabolism
    Sama_2381
Enzymes [BR:saz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sama_2381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2859826..2861457)
Genome map
AA seq 543 aa AA seqDB search
MTEQMMEQPQTLTGLKLAGHHIQGQEEVFTEGAMSLLESLCARFAGDVDALLAKRKERQV
RIDKGELPDFLPETRAIRDGKWTIRGIPTDLQDRRVEITGPVDRKMIINALNADVKVFMA
DFEDSLAPSWEKVIQGQINLRDAVRGTIEYKAPDTGKEYRLNDNPAVLIARVRGLHLKEK
HVEFNGQSIPGALFDFCFYFYHNYRQLLSKGSGPYFYIPKLESHLEARWWAKVFAFTEER
FCLEPGTIKCTCLIETLPAVFEMDEILYELRSNIVALNCGRWDYIFSYIKTLKHHSDRVL
PDRQQVTMDKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPAKDAEANRLVLERVCKDKEL
EARNGHDGTWVAHPGLAQTAMAVFNQFIGDDHCNQLHITRDVDAPILASELLAPCEGERT
EHGMRLNIRIALQYIEAWISGNGCVPIYGLMEDAATAEISRASIWQWIHHQKHLSNGKLV
TKALLKEMLVEELANVKEEVGSERFTHGRFTQAAVLLEEITTADELVDFLTLPGYELLTK
QEH
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgacagagcaaatgatggagcagccacagacactgaccgggctcaagctggcgggtcat
catatccaggggcaggaagaagtctttactgaaggcgcaatgtcgctgcttgagtccctg
tgtgccaggtttgcaggcgacgtggatgccttactggctaaacgtaaagaacgccaggtt
cgcattgataaaggtgagttgccggatttcctgccggagacacgcgccatacgtgatggt
aagtggaccattcgtggcataccaaccgacttgcaggatcgccgggtggaaatcactggt
cccgtggaccgcaagatgatcatcaatgccctgaatgccgatgtgaaagtctttatggct
gactttgaggattcattggcacccagctgggaaaaggtgattcaggggcaaatcaacctg
cgtgatgcggtgcgtggcaccattgaatataaagcgcccgatacaggtaaagagtaccgc
ttgaacgataatccagcggtgctgattgccagggtgcgcggcttacacctcaaagaaaaa
cacgtggaatttaacggccaatcgatcccgggagccctgtttgatttctgtttctacttt
tatcacaactaccgtcagttactgagtaaaggcagtgggccgtacttttatatccccaag
ctcgagagccatctcgaggcgcgttggtgggccaaggtctttgcctttaccgaagagcgt
ttctgcctcgagccgggcacaatcaagtgtacctgtttgatagaaaccctgccggccgtg
tttgaaatggacgaaatcctctatgagctgcgctccaatatcgttgcgctcaactgtggt
cgatgggattacatcttcagctatatcaaaaccttgaaacaccacagtgatcgcgtactg
cctgacaggcaacaagtcaccatggataagccgttcctcagcgcctattcgcgtctgctg
atcaaaacttgtcacaagcggggagcccttgcgatgggcggtatggcggctttcattcca
gccaaagatgccgaagccaaccgcctggtgcttgaacgggtttgcaaagacaaggagctg
gaagcccgtaacggccatgacggcacctgggtcgcccatcccggtctggcacaaacggcg
atggccgtgtttaaccagtttatcggtgatgaccactgcaatcagctgcacatcacccgt
gatgtggatgcgccgattttggccagcgagctgctggcgccctgcgagggtgagcgcacc
gagcacggtatgcgactgaatattcgcattgcgctgcagtacatcgaggcctggatcagt
ggcaatggttgtgtgcccatttatggtctgatggaagatgccgccacggcggaaatctcc
cgcgcctccatctggcaatggatccatcatcagaagcacctatccaacggcaaacttgtg
accaaggcactgctgaaggaaatgctggtggaggagcttgccaacgtcaaagaagaagtg
ggcagcgagcgctttacccacggcagatttacccaagcggctgtgctgctggaggagatc
acgaccgccgacgagctggtcgacttcctgacactgccgggctacgagctgctgaccaaa
caagaacactga

DBGET integrated database retrieval system