KEGG   Shewanella amazonensis: Sama_2381Help
Entry
Sama_2381         CDS       T00445                                 

Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
saz  Shewanella amazonensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sama_2381
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sama_2381
   00630 Glyoxylate and dicarboxylate metabolism
    Sama_2381
Enzymes [BR:saz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sama_2381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2859826..2861457)
Genome map
AA seq 543 aa AA seqDB search
MTEQMMEQPQTLTGLKLAGHHIQGQEEVFTEGAMSLLESLCARFAGDVDALLAKRKERQV
RIDKGELPDFLPETRAIRDGKWTIRGIPTDLQDRRVEITGPVDRKMIINALNADVKVFMA
DFEDSLAPSWEKVIQGQINLRDAVRGTIEYKAPDTGKEYRLNDNPAVLIARVRGLHLKEK
HVEFNGQSIPGALFDFCFYFYHNYRQLLSKGSGPYFYIPKLESHLEARWWAKVFAFTEER
FCLEPGTIKCTCLIETLPAVFEMDEILYELRSNIVALNCGRWDYIFSYIKTLKHHSDRVL
PDRQQVTMDKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPAKDAEANRLVLERVCKDKEL
EARNGHDGTWVAHPGLAQTAMAVFNQFIGDDHCNQLHITRDVDAPILASELLAPCEGERT
EHGMRLNIRIALQYIEAWISGNGCVPIYGLMEDAATAEISRASIWQWIHHQKHLSNGKLV
TKALLKEMLVEELANVKEEVGSERFTHGRFTQAAVLLEEITTADELVDFLTLPGYELLTK
QEH
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgacagagcaaatgatggagcagccacagacactgaccgggctcaagctggcgggtcat
catatccaggggcaggaagaagtctttactgaaggcgcaatgtcgctgcttgagtccctg
tgtgccaggtttgcaggcgacgtggatgccttactggctaaacgtaaagaacgccaggtt
cgcattgataaaggtgagttgccggatttcctgccggagacacgcgccatacgtgatggt
aagtggaccattcgtggcataccaaccgacttgcaggatcgccgggtggaaatcactggt
cccgtggaccgcaagatgatcatcaatgccctgaatgccgatgtgaaagtctttatggct
gactttgaggattcattggcacccagctgggaaaaggtgattcaggggcaaatcaacctg
cgtgatgcggtgcgtggcaccattgaatataaagcgcccgatacaggtaaagagtaccgc
ttgaacgataatccagcggtgctgattgccagggtgcgcggcttacacctcaaagaaaaa
cacgtggaatttaacggccaatcgatcccgggagccctgtttgatttctgtttctacttt
tatcacaactaccgtcagttactgagtaaaggcagtgggccgtacttttatatccccaag
ctcgagagccatctcgaggcgcgttggtgggccaaggtctttgcctttaccgaagagcgt
ttctgcctcgagccgggcacaatcaagtgtacctgtttgatagaaaccctgccggccgtg
tttgaaatggacgaaatcctctatgagctgcgctccaatatcgttgcgctcaactgtggt
cgatgggattacatcttcagctatatcaaaaccttgaaacaccacagtgatcgcgtactg
cctgacaggcaacaagtcaccatggataagccgttcctcagcgcctattcgcgtctgctg
atcaaaacttgtcacaagcggggagcccttgcgatgggcggtatggcggctttcattcca
gccaaagatgccgaagccaaccgcctggtgcttgaacgggtttgcaaagacaaggagctg
gaagcccgtaacggccatgacggcacctgggtcgcccatcccggtctggcacaaacggcg
atggccgtgtttaaccagtttatcggtgatgaccactgcaatcagctgcacatcacccgt
gatgtggatgcgccgattttggccagcgagctgctggcgccctgcgagggtgagcgcacc
gagcacggtatgcgactgaatattcgcattgcgctgcagtacatcgaggcctggatcagt
ggcaatggttgtgtgcccatttatggtctgatggaagatgccgccacggcggaaatctcc
cgcgcctccatctggcaatggatccatcatcagaagcacctatccaacggcaaacttgtg
accaaggcactgctgaaggaaatgctggtggaggagcttgccaacgtcaaagaagaagtg
ggcagcgagcgctttacccacggcagatttacccaagcggctgtgctgctggaggagatc
acgaccgccgacgagctggtcgacttcctgacactgccgggctacgagctgctgaccaaa
caagaacactga

DBGET integrated database retrieval system