KEGG   Shewanella amazonensis: Sama_2453Help
Entry
Sama_2453         CDS       T00445                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
saz  Shewanella amazonensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sama_2453
Enzymes [BR:saz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Sama_2453
Exosome [BR:saz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sama_2453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2957271..2959796)
Genome map
AA seq 841 aa AA seqDB search
MTSVQSQDSTLISEDAARALARGQYVDVFSLLGMHADNNQLVVRCFLPGALAVEVLSAKD
GKKVASLSAEAREGMFAGVMGRRVKPFAYLLRVAYPSHVEDVYDPYGFDSLLSDYDLYLF
GEGRQLYAQDFLGANPREVEGVAGVLFGVWAPNASRVSVVGDFNHWDGRVHVMRFHPASG
VWDIFIPGVHAHAHYKFEIMTADGELLIKSDPFAKTMEAAPNNASRVAPQSSFVWQDQDW
MQARNKDWHRQAMSIYELHLGSWRRKGEAGDTWLTYRELADELVPYVKSLGFTHIELMPL
SEFPFDGSWGYQPVGLFAPTQRFGSSDDLKYLIDACHRAGIGVLMDWVIAHFPADAHGLA
RFDGTCLYEHQDPRRGRHPDWDTLIFNYGRAEVQSFLLSAATVWLRDFHIDGLRLDAVSS
MLYLDYSRSEGEWLPNADGGRENHEAIECLKLINSRLYGEFPGIVMIAEESTAWDGVCRP
VSEGGLGFGFKWNMGWMNDTLAYLGKDPIHRRWHHHQLTFGIMYAHSEQFILSLSHDEVV
HGKASLLSKIPGDDWQKFATLRAYYGYMWGFPGKKLLFMGGEFGQRDEWNHDKSLDWHLL
QYAPHQGLSLWLADLNRLYQRHTVLGQTDHDLSRFCWLDCDNAEQGIYAFVRGEGDDALV
FVVNMTPQLHQGYRLGLPCEGDWRELLNSDASCYGGCNQGNGGVIVCTPEPAGGKAQSAL
VTIPPLGCLVLGLSRDKSPAISSESSADKALPVKKAPASTAPALIKAKPGTKTKPVTQTK
PVTKAKASTTDNAPAKAKSGTKPSTKPSTKPSTTPSTKPSAKSVAKAPSNAAKTKAEDPG
L
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgtccagagccaagactcaaccctcatcagtgaagatgccgcccgcgcactg
gcccgtggccagtatgtggatgtcttctccttgctgggtatgcacgccgacaataaccag
ctggtggtgcgctgttttctgccgggggcactggcggtagaggtgctcagtgccaaagac
ggtaaaaaggtcgccagtctcagcgctgaggcccgggagggcatgtttgccggggtgatg
gggcgcagggtcaagccctttgcgtatctgctgcgggtagcctacccaagccatgtggaa
gatgtgtacgacccctatggctttgacagcctgctgagcgactacgacctctacctgttt
ggtgaggggcgtcagctttacgcccaggactttttgggcgccaatcccagagaggtggag
ggtgtggccggggtgctttttggcgtatgggcgcccaacgccagccgggtgtctgtggta
ggggatttcaaccactgggatggccgtgtccatgtgatgcgctttcatcctgccagcggt
gtgtgggacatctttattcccggcgtgcatgcccatgcccactacaaattcgaaataatg
accgccgatggtgagctgctgattaagtcagaccccttcgccaaaaccatggaagcggcc
cccaataacgcatccagagtcgctccccagtcatcctttgtctggcaggatcaggactgg
atgcaggcacggaataaagactggcatcgccaggccatgtccatttacgagctgcacctt
ggctcgtggcgccgtaaaggtgaggctggtgacacctggctcacctaccgtgagcttgcc
gatgaactggtgccctacgtgaagtcactgggctttacgcacatagagctgatgcccttg
tcggaattccccttcgatggctcctggggctatcagccggtggggctgtttgcccccaca
cagcgatttggcagcagcgacgacctgaaatacctgattgatgcctgtcaccgtgccggt
atcggtgtcctgatggattgggttattgcccacttcccggcggatgcccatggactggca
cgctttgatggcacctgcctgtatgaacatcaggacccccgccgtggccgtcaccctgac
tgggataccctgattttcaactacggccgcgccgaggtgcagagtttcctgttatcggcc
gccaccgtctggctgcgggattttcatatcgatgggctgcgcctggatgcggtctcttcc
atgttgtatctcgactacagccgcagcgaaggcgagtggctgcccaacgccgatggcggt
cgggaaaaccatgaggccattgaatgcctcaagctgataaacagccgtctgtacggcgag
tttcccggtatcgtgatgattgccgaggaatccaccgcctgggatggcgtgtgtcgccct
gtcagcgagggcggattggggtttggttttaagtggaacatggggtggatgaatgacacc
ctggcctatcttggcaaagatccaattcatcgccgctggcatcaccatcaactcaccttc
ggcatcatgtatgcccacagcgagcagtttatcttgtcgttaagccatgatgaggtggtc
cacggcaaggcatcgctgctgtcgaaaatccccggcgatgactggcagaaatttgccacc
ctgcgtgcctattacgggtatatgtggggtttccccggcaagaagctgctgtttatgggg
ggcgagtttggtcagcgggacgagtggaaccacgacaagagcctcgactggcacctgttg
cagtacgctccccatcaggggctgagcctgtggctggctgatctcaatcgtctctatcag
cgccacaccgtacttgggcaaacggatcacgacctgtcccgcttctgctggctggattgc
gacaatgccgagcaggggatttatgcctttgtccggggtgagggcgatgatgccctggta
tttgtggtgaacatgacgccccagctgcaccagggatatcgcctgggattgccctgcgag
ggtgactggcgcgagctgcttaacagcgatgccagctgctacggcggctgcaaccagggc
aacggcggcgtgattgtatgcacccctgagcccgctggcggcaaggctcaaagtgctctt
gtcaccattcctcccctgggctgcctggtgctggggctcagccgggataaatcgcccgcg
atttcgtctgagtcttcagccgacaaagcgctacccgtaaaaaaagccccggcctcaacc
gccccggccttaatcaaggccaagccaggaaccaagaccaagccagtaacccagaccaag
ccagtaaccaaggcaaaggcttctaccactgataacgcgcctgccaaagctaagtccggc
accaagcccagcactaagcccagcactaagcccagcactacgcccagcactaagcccagt
gccaagtcggtggccaaagcaccgtccaacgcggcaaaaaccaaagctgaggatcccggc
ctatga

DBGET integrated database retrieval system