KEGG   Shewanella amazonensis: Sama_2454Help
Entry
Sama_2454         CDS       T00445                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
saz  Shewanella amazonensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:saz00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2959842..2962073)
Genome map
AA seq 743 aa AA seqDB search
MGLEKLFYLQGVGDRFIDCDGREQAIPESARLAMLKSLMGLEQSPDGAEIAARVDTLDSL
PWTKLLLPLQWCFETRPSVECQLPENLKQDMELTLISEQGERVTLTLLARDAETTGDYQR
PDGRYLRCRYSLPTLAMGEFQLQLSHPVLGQGKGALLIIPEQAYGGPPGLGKRPWGLGIS
LFTLRSQRQWGIGDLADLQTLIELSSEVGCDFITLTPLHAPDIANPGLASPYSPWDRRFL
NPLYIAIDLVTEYSQLAQEFNGGDWRRERLILNQASQIDYPKLALLKYRALAKLFAAFGK
LDEFSGRRVRFERFVAEGGTALKDFCRDVSQRALSLEGEWHRDPALAEALQRDEFHAWLQ
FVADEQLSLCQLRCRQVGMSLGLVRDLAVGALAIGSEVSRSGVFCLNADIGAPPDPFARQ
GQNWGMPPMDPVALKDSALSHLKSLYRSNMQSCGALRIDHVMALTRLWCWPEGDDNGCYL
YYPQELMLAVLCLESHKNRCLLIGEDLGTVPPLLKGLLRERGILGNDVFYFCRDGSGFSA
PREHRAGAMLQLGNQDVPPFMAWWRGIDLGLLNQLGLLPSVEEAHLSRVAQCRGLLESLV
EAGWLRREALTWQPCDALLPAPAGNISAGTTSAGNATDSIRQGTAVFDALLNWLPGSRAK
LFSVSLWDLALESQPINIPGTSFEYPNWRARMSQSLESLWQSREFRARLEAIRAGRSQPQ
GGRPGPSVIGEAMASADDRERQN
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgggattggaaaagctcttttatctgcaaggtgtgggagacaggttcatcgactgcgat
ggccgagaacaagccatacccgaatccgctcggttggcaatgctcaaatccctgatgggc
ctcgaacagtcccccgacggggccgaaatagccgccagggtggacaccctcgacagcctc
ccttggactaagttgctgctgccgctgcaatggtgttttgaaacccgtccgtcagttgaa
tgccagctgcctgaaaacctgaagcaagacatggaattaaccctgatttcagagcagggg
gagcgtgtaacgctgacgcttttggcaagggatgccgagacgaccggtgattatcaaagg
cccgatggcagataccttcgctgtcgctattccctgccaacgctggccatgggggagttt
cagctgcagctgtcccaccctgtcctcggccagggaaagggagccttgctgattatcccc
gagcaggcctacggtggcccaccgggccttggcaagcgtccctggggcctggggataagc
ctgtttaccctgagaagccagcggcagtggggcatcggtgacctggccgacctgcaaacc
ctgatagaactctcctcagaagtcgggtgcgattttatcaccctgacgcccttgcatgcc
ccggacattgccaaccccggactcgcaagcccctacagcccctgggacaggcgctttctc
aatccactctatatcgccatcgacttggtgaccgaatacagccaattggcgcaggagttc
aatggcggcgactggcgccgggaacgccttattctcaaccaggcaagccagattgattac
cccaaacttgcgctgctgaagtatcgggcgctggcaaagttgttcgctgcttttggaaag
ctggatgaattcagcgggcggcgagtgcgcttcgaacgtttcgtggccgagggcggcacg
gcgctgaaggatttttgccgtgatgtaagccaaagggcattaagcctggagggggaatgg
catcgggacccagcgctggcagaagcgctgcaacgggacgagtttcatgcctggctgcag
tttgtggccgatgagcagttgtcgctgtgtcagcttcgctgccgtcaggtgggcatgtct
cttggtttggtgagggatttggccgtgggcgccctggctatcggcagtgaagtgagccgc
agtggcgtattttgccttaatgccgatatcggggcgccaccggaccccttcgcccgtcag
gggcaaaactggggcatgccgccgatggaccctgtggcgttgaaagactcggccttaagc
catcttaaatccctttatcgaagcaacatgcaaagctgtggcgcgctcagaatcgaccat
gtgatggccctgacccggttgtggtgctggccagaaggcgatgacaacggttgttacctc
tactatccccaggaactgatgctggcggtcttgtgccttgagagccacaaaaaccgctgc
ctcctgattggggaggatctcggcacagtgccgccgctgctcaagggcttgctgcgggag
cggggcattctcgggaacgacgtattttacttttgccgggatggcagcggattttccgcg
cctcgggagcacagagccggtgccatgttgcagcttggcaatcaggatgtgccgccattc
atggcctggtggcgcggcattgatctcggcttactcaatcagcttgggcttttgccgtct
gtggaagaggcgcacttgagcagagtcgcacagtgccggggtttgctcgaaagcctggtg
gaagccggatggctgcgccgggaggccctgacctggcagccctgtgatgcattactgcca
gcgccagcgggcaatatatcggcaggcactacatcggcaggtaacgccaccgacagtatt
cgtcaggggacggcggtttttgatgccttactcaactggctgcccggcagccgcgccaaa
ttgttttctgtcagcctttgggatctggcccttgaatcccagcccatcaatattcccggc
accagttttgagtaccccaattggcgtgcacgcatgagtcagtcattggagagcctttgg
caaagccgcgagttcagagcgcgactggaagcgattcgcgccgggcgcagtcagcctcaa
ggtgggcgcccaggcccgtctgtcataggcgaagccatggcatctgccgatgacagagag
cgccaaaactga

DBGET integrated database retrieval system