KEGG   Shewanella amazonensis: Sama_2738Help
Entry
Sama_2738         CDS       T00445                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
saz  Shewanella amazonensis
Brite
Enzymes [BR:saz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Sama_2738
Secretion system [BR:saz02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Sama_2738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3271872..3272600)
Genome map
AA seq 242 aa AA seqDB search
MKLTRTLTLLGSLALAPLVMAAPATPNDMLKQKIQSTLGLEVNSITASPVEGLYQAITNR
GVLYITADGSKLIHGNIYDLNNQMNNLTEKALAGPRLDMLKEFESKMLVYKAKDEKHVVT
VFTDITCGYCRKLHREMKDYNDLGITVRYLAYPRQGVPSPNADEMEAVWCAKDPHKAMDD
AKAGKNISLAKCDADIAGQYNLGGSFGVNGTPAIVLEDGSMIPGYQPASALFDVLEQRAV
KQ
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcacccgtaccctgacgcttttgggctcactggccctggctcccttggtgatg
gcggcccctgccacaccaaacgacatgctgaagcagaaaattcaaagcaccctcggcctg
gaagtgaacagcatcacagcctctccggttgaggggctgtatcaggccataaccaaccgt
ggtgtgttgtacatcactgccgatggcagcaagctgatccatggcaacatctatgatttg
aataaccagatgaacaacctgaccgaaaaggccctggctggtccgcgtctggacatgctc
aaagaatttgaaagcaagatgttggtgtataaagctaaagacgaaaaacacgtagtcact
gtctttaccgacattacctgcggttactgccgcaagctgcatcgtgagatgaaagactat
aacgaccttgggataaccgtgcgttatctggcgtatccccgccagggcgtaccttcgccc
aatgccgacgagatggaagccgtatggtgtgccaaagacccacacaaggccatggacgat
gccaaggccggtaaaaatatcagcctcgccaagtgtgatgcggacattgccggccagtac
aacctgggtggttcctttggcgtaaatggcacccccgccattgtgctggaagacggctcc
atgatccccggttatcaacctgcctccgcgctgtttgatgtgctggagcagcgtgcggtt
aagcagtaa

DBGET integrated database retrieval system