KEGG   Shewanella amazonensis: Sama_2893Help
Entry
Sama_2893         CDS       T00445                                 

Definition
phospholipase A(1)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
saz  Shewanella amazonensis
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Sama_2893
   00565 Ether lipid metabolism
    Sama_2893
   00590 Arachidonic acid metabolism
    Sama_2893
   00591 Linoleic acid metabolism
    Sama_2893
   00592 alpha-Linolenic acid metabolism
    Sama_2893
Enzymes [BR:saz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Sama_2893
    3.1.1.32  phospholipase A1
     Sama_2893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3435649..3436533
Genome map
AA seq 294 aa AA seqDB search
MKNLMRYLLPLLFISHAALAEEPSLVDERVKDELATSEQPFVITPHKVNYILPVTYNSSP
NMKPFEEEAAEHPFTLDEMEAKFQISFKFPLWYNVFGDNGHLFFAYTNQSYWQVYNKDIS
SPFRETNHEPELFMLFNNDWEVFGLTNSFWGFGAVHQSNGKAGDFSRSWNRVYGTMVFDR
GPLAIGAKVWWRIPEDEKEYEGDPHGDDNPDIEDYMGNFELQAVYGLEEHRFTMLLRNNL
DSPNRGAFEFTWSYPIIGNLRLYTQYFNGYGESLIDYNAHTQRVGIGISINDLL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacttaatgagatatttactacccctgttgtttatttcccatgctgccttggca
gaagaaccctctctggtggatgaaagggtgaaagatgagcttgctacctcagagcaaccc
ttcgtgatcaccccccataaggtgaactacatattgccggtgacctacaacagttccccc
aatatgaagcccttcgaagaagaagcggcggagcatcccttcaccctggacgagatggaa
gccaaattccagataagctttaagtttccactctggtataacgtctttggtgacaacggc
cacctgttttttgcctataccaaccagtcttactggcaggtatacaacaaagacatttcc
tcgccctttcgtgaaaccaaccacgaacctgagctctttatgttgttcaataacgactgg
gaagtgtttggcctgaccaactccttctggggctttggcgccgtacaccagtcaaatggc
aaggcaggtgatttctcccgcagctggaaccgcgtctacggcaccatggtgttcgaccgg
ggccccctggccattggcgccaaggtatggtggcgaattccggaggatgaaaaagaatat
gaaggcgatccccatggcgatgacaacccggatatcgaagattacatgggcaattttgaa
ctgcaggctgtgtatggtctggaggaacatcgttttaccatgctgctcagaaacaatctc
gacagccctaaccggggtgcctttgagttcacctggagctatcccatcataggcaacctg
cgactctatacccaatacttcaatggttatggtgagagcctgatagactataacgctcac
acccaaagggttggtattggcatatcaatcaacgacttactttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system