KEGG   Shewanella amazonensis: Sama_2924Help
Entry
Sama_2924         CDS       T00445                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
saz  Shewanella amazonensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:saz00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:saz00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:saz02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3478408..3480177)
Genome map
AA seq 589 aa AA seqDB search
MKRSYSRRDFLAMSAKGVGAAVVSYGLMGCSSSDDDAPSVPVSFVHGVASGDPAHDAVII
WTRVTPTGDADLTVSWQVAKDADFKELVTDGSTMTNKDRDYTVKVDAMGLAAGSSYYFRF
MCGDKTSAVGKTRTLPEGAVSQVKLAVMSCANFPAGYFNVYELAAAQGSLDAVVHLGDYI
YEYPRGGYASENAAAIGREVLPAHELLSLGDYRTRYAQYRGDASLQKLHAMVPFITVWDD
HEVCNDAWRDGAENHNEGEGDFEARKQAALQAYFEWLPIRPWREGNHEEIFRSFAFGDLV
DLHMLDTRLLGRDEQLQFETYLDPATGAFDGTSFMADVTSTSRTMLGALQLLWLQSKLLA
NEAKWQVLGQQVLMGKMLLPAAIATQQLSIPQFAELAGLAQLAARAQAGDPTLTQEELMY
LAANQHKLTPEVIALLQLPSIPYNLDAWDGYAYEREVILGTARSVNANLVVLAGDTHNAW
ANELKDVNGAAVGVEFATSSVSSPGLEYYLQLPAEQIPATEAAVVGLVDDLKYANLKDRG
FMVLTFTQEEVRSDWIYVSSILEKDFTEATGRGYSARTLAGSHVIEAVV
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggtcttattcacgtcgtgacttcctggccatgtcggccaaaggcgttggtgcc
gcagtggtttcctatggcctgatgggctgctccagcagcgatgatgatgccccatctgtg
ccggtcagcttcgttcacggtgttgccagtggtgacccggcccatgacgctgtcatcatc
tggacccgggtgactcccaccggcgatgccgacctgactgtctcctggcaggtggccaaa
gatgccgacttcaaagagctggtcacagacggcagcaccatgaccaataaagacagggat
tacacagtcaaagtggatgccatgggccttgccgccggcagcagctattacttccgcttt
atgtgcggcgacaaaacctcggctgtgggcaaaacccgcaccctgccagagggcgccgtg
tcccaggtgaaactggcggtaatgagctgcgccaacttcccggccggttactttaacgtt
tacgagctggcagcggcccagggttcactggatgcggttgtgcatctgggcgactatatc
tacgaatatccccgtggcggttatgccagtgaaaacgcggcggccatcggccgtgaggta
ttaccggcccatgaactcctgagcctgggcgactaccgtacccgttacgctcagtatcgc
ggtgatgccagtctgcaaaagctccacgccatggtgccctttattacagtgtgggatgac
catgaagtctgtaacgatgcctggcgtgatggcgctgaaaaccacaatgaaggcgagggc
gactttgaggcccgtaagcaggcggcgctgcaggcttactttgaatggctgcctattcgc
ccatggcgcgaaggcaaccatgaagaaatcttccgaagctttgcctttggcgatctggta
gatctgcacatgctggatacccgtttgcttggccgtgatgagcagctgcagtttgaaacc
taccttgacccagccactggcgccttcgatggcaccagctttatggccgatgtcaccagc
accagccgcaccatgctgggcgcactgcagctgctgtggctgcaaagcaagttactggca
aacgaagccaaatggcaggtactgggccaacaggtgttgatgggcaagatgttgttgccc
gcggccattgccacccaacagctgtctattcctcagtttgccgagctggccggtctggca
cagctcgccgcccgcgctcaggcgggcgatcctaccctgacccaagaagagctgatgtat
ctggcggccaaccagcataagctgacgccggaagtcattgccctgctgcaactgccatcc
attccctacaacctcgatgcctgggacggttacgcctacgagcgtgaggtgattctgggt
acggccaggtcggtgaatgccaatttggtggtgctggccggtgatacccacaacgcctgg
gccaacgagctcaaagacgtgaacggcgccgccgttggcgtggagtttgcgaccagctca
gtgtcgtcgccggggctggagtactacctgcaattgccggccgaacaaattccggccacc
gaagcggcagtggtggggctggtggacgacctcaagtacgccaacctcaaggacaggggc
tttatggtactgaccttcacccaggaagaagtgcgcagcgactggatttatgtctcgtcc
attctggagaaagatttcaccgaggccacgggccgtggctacagcgcccgcaccctggcg
ggcagccatgtgatagaggctgtggtgtaa

DBGET integrated database retrieval system