KEGG   Shewanella amazonensis: Sama_3277Help
Entry
Sama_3277         CDS       T00445                                 

Definition
serine--pyruvate transaminase
Orthology
K00830  
alanine-glyoxylate transaminase / serine-glyoxylate transaminase / serine-pyruvate transaminase [EC:2.6.1.44 2.6.1.45 2.6.1.51]
Organism
saz  Shewanella amazonensis
Pathway
Alanine, aspartate and glutamate metabolism
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sama_3277
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Sama_3277
  Energy metabolism
   00680 Methane metabolism
    Sama_3277
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sama_3277
   00260 Glycine, serine and threonine metabolism
    Sama_3277
Enzymes [BR:saz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.44  alanine---glyoxylate transaminase
     Sama_3277
    2.6.1.45  serine---glyoxylate transaminase
     Sama_3277
    2.6.1.51  serine---pyruvate transaminase
     Sama_3277
Amino acid related enzymes [BR:saz01007]
 Aminotransferase (transaminase)
  Class V
   Sama_3277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3891856..3892986)
Genome map
AA seq 376 aa AA seqDB search
MQAAPKIAPFMPPRRILMGPGPSDVYPEVLLAQSRPTVGHLDPLFVAMMDELKALLQYAF
QTQNEVTLAVSAPGSAGMETCFVNLVEPGEKVVVCRNGVFGERMRQNVERCGGVAVVVDF
PWGAPVDPQVVEGVLKQHPDASYLAFVHAETSTGALSDAKTLCALAREHNCLSIVDAVTS
LGGVELRVDEWGIDAIYSGSQKCLSCVPGLSPVSFSPRAVEKLKSRKTPVQSWFLDQTLV
MGYWGGSGKRAYHHTAPVNALYALHESLRLLAEEGLENAWARHQHMHQLLKAGLEKLGLG
FVVDEAYRLPQLNAVYIPEGVDDAAVRSQLLKGYNLEIGAGLGDLAGKAWRIGLMGYGAR
AENVAICLKALEEVLQ
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccgctcccaagatagcgccctttatgccgccacgccgtattctgatgggcccg
ggcccttcagatgtgtatcccgaggtgttgctggcccagtcacgccccaccgtgggccat
ctggaccccttgtttgtggccatgatggatgagctcaaagcgctgctgcaatatgccttt
cagacccaaaacgaagtgaccttggcggtatcggctccaggcagcgccggtatggaaacc
tgttttgtaaacctggtggagcctggcgagaaggttgtggtttgccgcaatggggtgttt
ggcgagcggatgcgccagaacgtggagcgctgcggcggtgttgccgtggtggtggatttc
ccctggggcgcaccggtcgacccgcaagtggttgaaggtgtgctgaagcagcatccggat
gcaagctaccttgcctttgtccatgctgaaaccagcacgggcgcgctgtcggacgccaaa
accctgtgtgctcttgcccgcgaacataactgcctgtcgattgtggatgcggtgacctcc
cttggtggggttgaactcagggtcgatgagtggggcatagatgccatttattcgggcagc
cagaagtgcttatcctgtgtacccggcttatcgcctgtgtccttctcaccccgagcggta
gagaagcttaaaagccgcaagacgccggtgcagagctggtttttggatcagactctggtg
atgggctattggggtggcagtggcaagcgcgcttaccaccataccgcgccggttaacgcc
ctgtatgccttgcacgaatcgttgcggctgctcgccgaagaaggcctcgaaaacgcctgg
gccagacatcaacacatgcatcagctgcttaaagccggcctcgaaaagttggggctcggc
tttgtggtggatgaggcttaccgcctgccgcaactcaacgccgtgtacattccagagggt
gtggatgacgctgccgtgcgcagccagctgcttaagggttataaccttgagattggtgcc
ggactcggagacctggcaggaaaggcttggcgaattgggctcatgggctatggcgcacgg
gccgaaaatgtggcaatttgcctgaaggctctggaagaggtgctgcagtaa

DBGET integrated database retrieval system