KEGG   Shewanella amazonensis: Sama_3499Help
Entry
Sama_3499         CDS       T00445                                 

Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
saz  Shewanella amazonensis
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:saz00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sama_3499
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Sama_3499
Enzymes [BR:saz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Sama_3499
Two-component system [BR:saz02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Sama_3499
Bacterial motility proteins [BR:saz02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Sama_3499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4130818..4131837
Genome map
AA seq 339 aa AA seqDB search
MIRVLIVDDSALVRKLLSHMLAQAEDIDVVGCAEDPYQAREMIKELNPDVITLDIEMPRM
DGIAFLRNLMKLRPMPVIMISTLTEKGAAVTLEALSLGAVDFISKPKHDLTNKLLDYQDE
LLEKVRQAAVSRVRALSAPPPESESSGKLKNRVIAIGASTGGTEAIQRLISMLPANFPPV
VIAQHIPAAFSASFAKRLDLNSQMQVVEAIGNEQLKVGNVYIAPGHAHLVIRRVGAHFRT
AILDTDPVNRHKPSVDVLFHSVAEVAGRAAVGVILTGMGRDGAQGLLHMREQGAYTIAQD
EDSSVVWGMPGSSVELGAACEQLHLDKIAPKLLSLLKSD
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgataagagtactcatcgtcgatgactctgctctggttaggaaattgctgagccatatg
ctggcgcaggcagaggacatcgatgtggtgggctgtgcagaagatccctatcaggccagg
gagatgattaaggagctcaacccggatgtgataactctggacattgaaatgccccgcatg
gatggcatcgcatttttacgcaacctgatgaagctgcgccccatgcccgtcatcatgatt
tccacactcacggaaaagggggccgccgtgactttggaggccctgtctcttggggccgtg
gactttatcagtaagcccaaacatgacctgaccaacaagctgctcgactatcaggatgaa
ctgctggaaaaagtccgtcaggcggcggtcagcagggtaagggccctttctgcaccacca
cctgagtctgagagctccggcaagctgaaaaaccgggtaattgccataggtgcttccacc
ggcggcacagaagccattcaacgactcatttccatgctgccagccaacttcccgcctgtg
gttatcgcacagcacatacccgctgccttcagtgcttcctttgccaaacgtctggacctg
aactcgcagatgcaagtggttgaggccatcggcaatgagcaattaaaagtcggcaacgtc
tatatcgccccgggtcacgcccatctggtcattcgccgggtaggcgcccactttcgcacc
gccattttggacacagacccggtgaatcggcacaaaccctcggtggatgtgctgtttcac
agtgtggcagaagtcgcaggcagggctgcagtgggcgtgattctcaccggtatggggcgt
gatggcgcccagggactgctgcatatgcgggaacagggagcctacacaatagctcaggat
gaagacagctctgttgtgtggggcatgccgggcagctccgttgagctgggtgccgcctgt
gagcagctccatctggacaagattgcacccaagctgctcagtttactcaaatcagattag

DBGET integrated database retrieval system