KEGG   Shewanella amazonensis: Sama_3499Help
Entry
Sama_3499         CDS       T00445                                 

Definition
(GenBank) Protein-glutamate methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
saz  Shewanella amazonensis
Pathway
saz02020  Two-component system
saz02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:saz00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sama_3499
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Sama_3499
Enzymes [BR:saz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Sama_3499
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Sama_3499
Two-component system [BR:saz02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Sama_3499
Bacterial motility proteins [BR:saz02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Sama_3499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: ABM01702
JGI: Sama3499
UniProt: A1SBE5
Position
4130818..4131837
Genome map
AA seq 339 aa AA seqDB search
MIRVLIVDDSALVRKLLSHMLAQAEDIDVVGCAEDPYQAREMIKELNPDVITLDIEMPRM
DGIAFLRNLMKLRPMPVIMISTLTEKGAAVTLEALSLGAVDFISKPKHDLTNKLLDYQDE
LLEKVRQAAVSRVRALSAPPPESESSGKLKNRVIAIGASTGGTEAIQRLISMLPANFPPV
VIAQHIPAAFSASFAKRLDLNSQMQVVEAIGNEQLKVGNVYIAPGHAHLVIRRVGAHFRT
AILDTDPVNRHKPSVDVLFHSVAEVAGRAAVGVILTGMGRDGAQGLLHMREQGAYTIAQD
EDSSVVWGMPGSSVELGAACEQLHLDKIAPKLLSLLKSD
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgataagagtactcatcgtcgatgactctgctctggttaggaaattgctgagccatatg
ctggcgcaggcagaggacatcgatgtggtgggctgtgcagaagatccctatcaggccagg
gagatgattaaggagctcaacccggatgtgataactctggacattgaaatgccccgcatg
gatggcatcgcatttttacgcaacctgatgaagctgcgccccatgcccgtcatcatgatt
tccacactcacggaaaagggggccgccgtgactttggaggccctgtctcttggggccgtg
gactttatcagtaagcccaaacatgacctgaccaacaagctgctcgactatcaggatgaa
ctgctggaaaaagtccgtcaggcggcggtcagcagggtaagggccctttctgcaccacca
cctgagtctgagagctccggcaagctgaaaaaccgggtaattgccataggtgcttccacc
ggcggcacagaagccattcaacgactcatttccatgctgccagccaacttcccgcctgtg
gttatcgcacagcacatacccgctgccttcagtgcttcctttgccaaacgtctggacctg
aactcgcagatgcaagtggttgaggccatcggcaatgagcaattaaaagtcggcaacgtc
tatatcgccccgggtcacgcccatctggtcattcgccgggtaggcgcccactttcgcacc
gccattttggacacagacccggtgaatcggcacaaaccctcggtggatgtgctgtttcac
agtgtggcagaagtcgcaggcagggctgcagtgggcgtgattctcaccggtatggggcgt
gatggcgcccagggactgctgcatatgcgggaacagggagcctacacaatagctcaggat
gaagacagctctgttgtgtggggcatgccgggcagctccgttgagctgggtgccgcctgt
gagcagctccatctggacaagattgcacccaagctgctcagtttactcaaatcagattag

DBGET integrated database retrieval system