KEGG   Sulfurospirillum barnesii: Sulba_0062Help
Entry
Sulba_0062        CDS       T02139                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sba  Sulfurospirillum barnesii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sba00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sulba_0062
   00052 Galactose metabolism
    Sulba_0062
   00500 Starch and sucrose metabolism
    Sulba_0062
   00520 Amino sugar and nucleotide sugar metabolism
    Sulba_0062
Enzymes [BR:sba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sulba_0062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
55465..56334
Genome map
AA seq 289 aa AA seqDB search
MSSASKYSKINNLKSVKKCLFPAAGYGTRFLPATKAMPKEMLPVLTKPLIQYGVEEAVSA
GIDTMAIVTGRGKRAIEDHFDVSYELEHQIKGTSKESYLTEIRNLIDNCTFSYTRQVEMK
GLGHAILTGKTLIGDEPFAVILADDLCDNNEDDPVLKQMVEVYEKYRCCVVAIEEVPKEE
TNKYGVIDGKIVDGNESVLRVSNMVEKPDPKDAPTNLAIIGRYILTPDIFEVIENTKPGK
GGEIQITDALLELAKQGKVIAYKFNGRRFDCGSIEGFVEATNYFHSKTN
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaagtgcctcaaaatacagcaaaattaataatctaaaatccgttaaaaaatgcctc
ttcccagcagcaggctatggaacacgttttcttcccgcaaccaaagcaatgccaaaagag
atgttgcctgttttaactaaacctcttattcaatacggtgtggaagaagctgtgagtgca
ggtattgacacgatggctattgtaacaggtcgtggtaaaagagccattgaagaccatttt
gacgtgagctatgagcttgagcatcaaattaaaggaacctccaaagagagttacctcact
gaaattagaaatttgattgataattgtacctttagttacacaagacaagtggagatgaaa
ggattaggacatgcgattttaacgggtaaaacactgattggcgatgaaccatttgccgtt
attttggcagatgatttgtgtgacaataatgaggatgatcctgtcttaaaacagatggtt
gaagtgtatgaaaaataccgttgttgcgtggtcgccattgaagaagtgcctaaagaagag
accaataaatacggtgtgattgatggcaaaattgtcgatggcaatgaatctgtgcttcgt
gtctctaacatggtggaaaaaccagacccaaaagatgcacccaccaatttagcaattatt
ggacgttatattttaacccctgatatttttgaagtgattgaaaacacaaagccaggcaaa
ggtggagaaatccaaattaccgatgctcttttggaacttgccaaacaaggcaaagtcatt
gcgtataaattcaatggaagacgatttgactgtggttctattgaaggatttgttgaagcg
actaactactttcacagcaaaaccaactaa

DBGET integrated database retrieval system