KEGG   Sulfurospirillum barnesii: Sulba_0312Help
Entry
Sulba_0312        CDS       T02139                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sba  Sulfurospirillum barnesii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sba00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
291534..292001
Genome map
AA seq 155 aa AA seqDB search
MKLEKIRFFPTCKTTVAPYRYEAFIGIGGNEGNVKKRFVALYRLLQDDPRIFVQKSSSVF
QNPPFGYANQNDFYNAVMVIRTSLHVNALLKILLHVENKFRRIRLFENGPRTLDLDIIFF
NNYKRHQKHVIVPHPKWQERLSVRVPLLVLKRFKG
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattagagaaaattcgttttttccctacatgtaaaacaaccgtggcaccttatcgt
tatgaggcattcattggaataggtggtaatgaggggaatgttaaaaaacgttttgtggcg
ttataccgtttgctacaagacgatcctcgaatctttgtgcaaaagagttcatctgttttt
caaaacccaccctttggttatgccaaccaaaatgatttttacaatgcagtgatggtgata
cgaacctctttacatgtaaatgcattgctaaaaatacttttacatgtagagaataaattt
agacggattcgtctttttgaaaatggtccaagaacccttgatttagatataatatttttc
aataattacaagcgtcatcaaaaacatgtcatcgttcctcaccctaaatggcaggagcgt
ttatcggtgcgtgtaccgcttttagtattaaaacgttttaaaggatag

DBGET integrated database retrieval system