KEGG   Sulfurospirillum barnesii: Sulba_0426Help
Entry
Sulba_0426        CDS       T02139                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sba  Sulfurospirillum barnesii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sulba_0426
Enzymes [BR:sba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Sulba_0426
Exosome [BR:sba04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sulba_0426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
396133..397107
Genome map
AA seq 324 aa AA seqDB search
MFKRFRRLRMNATLRSLVRETTLSMDDFIYPLFARSGEGIKKEIGSMPGVFQMSIDEILK
ECKSLQELGINSIILFGIPEVKDSVGSDALCEHGIIASTIKAVKKAYPNMFVVTDLCFCE
FTDHGHCGILDVEHESVNNDATLEILAKQALVHARSGVDMIAPSGMMDGMIEALREALDG
EGFINLPIMSYSTKFASAYYGPFRDVAESAPSFGDRKTYQMDPANRREAINESVEDEAQG
ADILMVKPALAYLDIIRDVRNATSLPLCVYNVSGEYAMLKAAGRAGVIDYERVMMETMIA
FKRAGADIIISYHAKEVAEILKRK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaagatttagaagactgagaatgaatgcaacgcttcgctcacttgtacgtgag
acaaccttgagtatggatgattttatttaccccttatttgcgagaagcggagagggcatt
aaaaaagagattggctcgatgccaggtgtttttcagatgagcattgatgagattttaaaa
gagtgtaaaagcttgcaggaacttggaattaactcaattattttatttggaattcctgag
gttaaagacagtgtgggaagtgatgcactgtgcgagcatggaattatcgctagtaccatt
aaagccgttaaaaaggcgtatccaaacatgtttgtcgtgactgatttgtgtttttgtgaa
tttaccgaccatgggcattgtggcattttggatgtggaacatgagagtgttaataacgat
gcgaccttagaaattttagccaaacaagccctcgttcatgcacgctcaggtgtagatatg
atagccccctctggcatgatggatggcatgatagaagccttacgtgaagcactcgatggc
gaaggttttattaaccttccgattatgagttattcgaccaaatttgccagtgcctattat
ggaccgtttcgtgatgtggcagagtccgccccttcttttggtgatagaaaaacctaccaa
atggatcctgccaatcgcagagaagctattaatgagtcggtggaagatgaagcgcaaggg
gctgacatcttgatggtcaagccagcccttgcatacctagacatcatccgtgatgtacgc
aatgccacctccttacctttgtgtgtgtacaatgtgagtggagaatatgccatgctaaaa
gctgctgggcgtgcgggtgtcattgattatgagcgtgtgatgatggagacgatgattgcg
tttaaacgtgcgggggctgacattatcatcagttatcacgctaaagaagtagcagaaatt
ttaaaaaggaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system