KEGG   Sulfurospirillum barnesii: Sulba_0426Help
Entry
Sulba_0426        CDS       T02139                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sba  Sulfurospirillum barnesii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sba00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
396133..397107
Genome map
AA seq 324 aa AA seqDB search
MFKRFRRLRMNATLRSLVRETTLSMDDFIYPLFARSGEGIKKEIGSMPGVFQMSIDEILK
ECKSLQELGINSIILFGIPEVKDSVGSDALCEHGIIASTIKAVKKAYPNMFVVTDLCFCE
FTDHGHCGILDVEHESVNNDATLEILAKQALVHARSGVDMIAPSGMMDGMIEALREALDG
EGFINLPIMSYSTKFASAYYGPFRDVAESAPSFGDRKTYQMDPANRREAINESVEDEAQG
ADILMVKPALAYLDIIRDVRNATSLPLCVYNVSGEYAMLKAAGRAGVIDYERVMMETMIA
FKRAGADIIISYHAKEVAEILKRK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaagatttagaagactgagaatgaatgcaacgcttcgctcacttgtacgtgag
acaaccttgagtatggatgattttatttaccccttatttgcgagaagcggagagggcatt
aaaaaagagattggctcgatgccaggtgtttttcagatgagcattgatgagattttaaaa
gagtgtaaaagcttgcaggaacttggaattaactcaattattttatttggaattcctgag
gttaaagacagtgtgggaagtgatgcactgtgcgagcatggaattatcgctagtaccatt
aaagccgttaaaaaggcgtatccaaacatgtttgtcgtgactgatttgtgtttttgtgaa
tttaccgaccatgggcattgtggcattttggatgtggaacatgagagtgttaataacgat
gcgaccttagaaattttagccaaacaagccctcgttcatgcacgctcaggtgtagatatg
atagccccctctggcatgatggatggcatgatagaagccttacgtgaagcactcgatggc
gaaggttttattaaccttccgattatgagttattcgaccaaatttgccagtgcctattat
ggaccgtttcgtgatgtggcagagtccgccccttcttttggtgatagaaaaacctaccaa
atggatcctgccaatcgcagagaagctattaatgagtcggtggaagatgaagcgcaaggg
gctgacatcttgatggtcaagccagcccttgcatacctagacatcatccgtgatgtacgc
aatgccacctccttacctttgtgtgtgtacaatgtgagtggagaatatgccatgctaaaa
gctgctgggcgtgcgggtgtcattgattatgagcgtgtgatgatggagacgatgattgcg
tttaaacgtgcgggggctgacattatcatcagttatcacgctaaagaagtagcagaaatt
ttaaaaaggaaataa

DBGET integrated database retrieval system