KEGG   Sulfurospirillum barnesii: Sulba_0448Help
Entry
Sulba_0448        CDS       T02139                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sba  Sulfurospirillum barnesii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sulba_0448
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sulba_0448
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sulba_0448
Enzymes [BR:sba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sulba_0448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
417939..418679
Genome map
AA seq 246 aa AA seqDB search
MKQLVAYITAGFPDKNFSLDLVSTLKEAGVDKLELGIPFSDPVADGPIIERANLCSLQNG
FKMETLFEISATVAPQIETYWMGYFNPFYHKGVDFFAQKATDLGVKGFIIPDLPHEEALP
YRSLMNKHVLSMVSFVAPTDSKERIAQLVKDAKGFIYLVAYAGITGSHASEDLTQTIQTI
KSHSQTPLFVGFGVNEKTAKERVRGADGVIVGSAFVEVLLNEHLSASEKIATIGQKAKMI
KEKINA
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcaattagttgcctatattacagcgggatttcccgataaaaatttttccctagat
ttggtttctactctaaaagaagcgggcgttgataaattagaattgggtattcctttttca
gatcctgtcgcagatggtcccattattgaacgtgccaatttatgctctttgcaaaatggt
tttaaaatggagactctttttgaaatttctgcaacagttgcaccgcaaattgaaacttat
tggatggggtatttcaatcctttttaccacaaaggtgtggatttttttgcacaaaaagca
actgatttaggtgtaaaagggtttattattcccgatttgccacacgaagaggcattacct
taccgctctttaatgaataagcatgtgctttctatggtaagttttgttgctccaaccgat
agtaaagagagaattgctcagcttgtgaaagatgctaaagggtttatttacttggttgca
tatgcaggcattacaggctcccacgccagtgaagatttaacccaaaccattcaaacgatc
aagtcacacagccaaacacctttatttgttggttttggtgtgaatgaaaaaacagctaaa
gagcgtgttcgtggagcggatggggtgattgtgggaagtgcttttgtcgaagttttattg
aatgagcatttaagtgcttcagaaaaaattgcgactattggacaaaaagcaaaaatgatt
aaagaaaaaattaacgcataa

DBGET integrated database retrieval system