KEGG   Sulfurospirillum barnesii: Sulba_0456Help
Entry
Sulba_0456        CDS       T02139                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
sba  Sulfurospirillum barnesii
Pathway
sba00230  Purine metabolism
sba01100  Metabolic pathways
Module
sba_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sba00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Sulba_0456
Enzymes [BR:sba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Sulba_0456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 RsgA_GTPase MMR_HSR1 AAA_33 AAA_22 ABC_tran AAA_29 AAA T2SSE RNA_helicase ATPase_2 DUF815 AAA_5 cobW NACHT Cytidylate_kin CoaE Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: AFL67774
UniProt: I3XV00
Position
424937..425551
Genome map
AA seq 204 aa AA seqDB search
MKGNLLVLSGPSGSGKSSLIKEVLLEIEDAYFSISSTTREPREGEVDGVNYHFVSKDEFE
RDIDAGFFLEWAKVHDNYYGTSLKPILKELQKGKLVMCDIDVQGHKIAQEKFASLITSVF
VTTSDQKSLQERLLKRGTDTHEVIERRLANAVSEMTCMNEYDFVLINDDFKTALHDMLAI
AYASRRKISLMDVSEFISSWANIE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaggaaatcttttagttctttcagggcctagtggttctggtaaaagttctttaata
aaagaggttttattggaaatcgaagatgcttatttttctatttctagtaccactcgagag
ccaagagagggagaagtggatggtgttaattatcactttgtttcaaaagatgaatttgaa
cgtgatattgatgcaggattttttttagagtgggcgaaagtacacgataattattacgga
acatcactcaagcctattttaaaagagcttcaaaaaggtaagttagtgatgtgtgatatt
gatgtgcaaggacataaaattgcacaagaaaaatttgcctcattaattacctctgttttt
gttacgacttctgatcaaaaaagtttacaagaacggttgctaaaacgaggaacagacact
catgaggtgatagaaagacgattggcaaatgccgtctctgaaatgacctgtatgaatgag
tacgattttgtacttattaatgatgattttaaaacggcgttacacgatatgttagctatt
gcatatgcatcacgacgaaaaatatctttaatggatgtcagtgaatttattagttcatgg
gcgaatattgaatag

DBGET integrated database retrieval system