KEGG   Sulfurospirillum barnesii: Sulba_0464Help
Entry
Sulba_0464        CDS       T02139                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
sba  Sulfurospirillum barnesii
Brite
Enzymes [BR:sba01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Sulba_0464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
432550..433578
Genome map
AA seq 342 aa AA seqDB search
MQISKVIGLCALSATVVFGASSLVQKVKDNGIEAIPTSQLEILKLIDDPKDPITDAKVEL
GKKLYFDPRMSKSSLISCNTCHNLALGGVDGIAAAIGHGWTANPAHLNSPTVYNSVFFKA
QFWDGRSPHLADQAQGPVQAGPEMAAPPKLVEERINSIPEYVNAFKVAYGDSVKITFEKI
TDTIATFEKTLITPSRFDDFMNGNENALSKAEKEGLEVFMDKGCAACHNGIALGGTMQPF
QIAAKYKFASLGGFQGDKDGMVKTPTLRNISETAPYYHNGAIWTLKEAIQEMGSTQLGIS
ISDAESAKIETFLKALKGRKPTIVYPELPESTAKTPKPDAKL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatttctaaggttattggtctttgtgcactcagtgcaacggttgtttttggtgca
agtagtttggttcaaaaggtaaaggataatggcattgaagccattccaacgagtcaattg
gagattcttaaactgattgatgaccccaaagatcctataacagatgcaaaggtagaattg
ggcaaaaaactctactttgaccctagaatgtcaaaaagttccttaattagctgtaatacc
tgtcataatttagctttgggtggggtcgatggcattgctgcagccattggacatggttgg
acagccaatccagcacacctgaactctccaacagtctataactctgttttctttaaagca
caattttgggatggtagaagtccccatttagcggatcaagcacaaggccccgttcaagca
ggtcctgagatggctgcacctccaaaattggtagaagagcgtatcaattctattccagaa
tatgtgaatgcttttaaagttgcttacggtgatagcgttaaaattactttcgagaaaatt
acggatacgatcgcaacatttgaaaaaacgcttattacgccctcacgttttgatgatttt
atgaatgggaacgagaatgcgctttcaaaagcagaaaaagagggcttagaggtttttatg
gataaaggatgtgctgcatgtcacaacggtattgccttagggggcacgatgcaaccattt
caaattgctgcaaaatataaatttgcttctttaggaggctttcaaggggataaagatggt
atggttaaaaccccaacgcttcgaaacattagcgaaacagcaccgtattatcacaatgga
gccatttggacacttaaagaagccattcaagagatgggaagtacacaacttggtattagt
attagcgatgcagagagtgcaaaaattgaaaccttcttaaaggcattaaaaggaagaaaa
cctacgattgtctatccagaattgcctgaaagtactgcaaaaacgccaaagcctgacgct
aagctctaa

DBGET integrated database retrieval system