KEGG   Sulfurospirillum barnesii: Sulba_0468Help
Entry
Sulba_0468        CDS       T02139                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sba  Sulfurospirillum barnesii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sulba_0468
   01230 Biosynthesis of amino acids
    Sulba_0468
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sulba_0468
   00051 Fructose and mannose metabolism
    Sulba_0468
   00562 Inositol phosphate metabolism
    Sulba_0468
Enzymes [BR:sba01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sulba_0468
Exosome [BR:sba04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sulba_0468
  Exosomal proteins of bladder cancer cells
   Sulba_0468
  Exosomal proteins of melanoma cells
   Sulba_0468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
436835..437548
Genome map
AA seq 237 aa AA seqDB search
MMIASNFKTNYTRATAEVFIKTVQAFLVQTHNEQEVRIFAPFTALNRFDEVKNLKVGVQN
FYPVQNGSFTGEIGFEQLEEFGIESVLIGHSERRHILKESHALIAQKYDFAKARDAEIIY
CVGEPAEVRMQGIDAVMSYLWEQFEGIDVHYEKLIIAYEPVWAIGTGLSAHLDDIKEVLE
RLREKLSKPLLYGGSVKVENIESILHVKACDGVLVGTASWNEEAFCEMIRIADSVKK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgatgattgcttcaaatttcaaaacaaattacacacgtgccacagcagaggtgtttatt
aaaacggttcaggcatttcttgtgcagacacacaatgagcaagaagttcgcatttttgct
ccttttaccgcattgaatcgttttgatgaggtcaaaaatcttaaagtcggtgtgcaaaat
ttttaccctgtgcaaaatggctcttttacaggagaaattggttttgaacagctagaagag
tttgggattgagagcgttttaattgggcacagtgaacgtcgtcatattttaaaagaatcc
catgcgttgattgcgcaaaagtatgattttgcaaaagccagagatgcagaaattatttac
tgcgtgggtgaacctgctgaggttcgcatgcaaggcattgatgcagtgatgagctatttg
tgggagcaatttgagggaattgatgttcattatgagaagttgattattgcgtatgagcct
gtttgggcgattggtacaggactgagcgcacatttagatgatattaaagaagtcttagaa
cgcttacgtgaaaagctttccaaaccactgttatatgggggcagtgtcaaagtagaaaat
atcgaatctattttacatgtaaaggcgtgcgatggcgttttagttgggactgcaagttgg
aatgaagaagccttttgcgagatgattcgcattgctgatagtgtcaaaaaataa

DBGET integrated database retrieval system