KEGG   Sulfurospirillum barnesii: Sulba_0468Help
Entry
Sulba_0468        CDS       T02139                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sba  Sulfurospirillum barnesii
Pathway
sba00010  Glycolysis / Gluconeogenesis
sba00051  Fructose and mannose metabolism
sba00562  Inositol phosphate metabolism
sba01100  Metabolic pathways
sba01110  Biosynthesis of secondary metabolites
sba01120  Microbial metabolism in diverse environments
sba01130  Biosynthesis of antibiotics
sba01200  Carbon metabolism
sba01230  Biosynthesis of amino acids
Module
sba_M00002  Glycolysis, core module involving three-carbon compounds
sba_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sulba_0468
   00051 Fructose and mannose metabolism
    Sulba_0468
   00562 Inositol phosphate metabolism
    Sulba_0468
Enzymes [BR:sba01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sulba_0468
Exosome [BR:sba04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sulba_0468
  Exosomal proteins of bladder cancer cells
   Sulba_0468
  Exosomal proteins of melanoma cells
   Sulba_0468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM BtpA
Motif
Other DBs
NCBI-ProteinID: AFL67786
UniProt: I3XV12
Position
436835..437548
Genome map
AA seq 237 aa AA seqDB search
MMIASNFKTNYTRATAEVFIKTVQAFLVQTHNEQEVRIFAPFTALNRFDEVKNLKVGVQN
FYPVQNGSFTGEIGFEQLEEFGIESVLIGHSERRHILKESHALIAQKYDFAKARDAEIIY
CVGEPAEVRMQGIDAVMSYLWEQFEGIDVHYEKLIIAYEPVWAIGTGLSAHLDDIKEVLE
RLREKLSKPLLYGGSVKVENIESILHVKACDGVLVGTASWNEEAFCEMIRIADSVKK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgatgattgcttcaaatttcaaaacaaattacacacgtgccacagcagaggtgtttatt
aaaacggttcaggcatttcttgtgcagacacacaatgagcaagaagttcgcatttttgct
ccttttaccgcattgaatcgttttgatgaggtcaaaaatcttaaagtcggtgtgcaaaat
ttttaccctgtgcaaaatggctcttttacaggagaaattggttttgaacagctagaagag
tttgggattgagagcgttttaattgggcacagtgaacgtcgtcatattttaaaagaatcc
catgcgttgattgcgcaaaagtatgattttgcaaaagccagagatgcagaaattatttac
tgcgtgggtgaacctgctgaggttcgcatgcaaggcattgatgcagtgatgagctatttg
tgggagcaatttgagggaattgatgttcattatgagaagttgattattgcgtatgagcct
gtttgggcgattggtacaggactgagcgcacatttagatgatattaaagaagtcttagaa
cgcttacgtgaaaagctttccaaaccactgttatatgggggcagtgtcaaagtagaaaat
atcgaatctattttacatgtaaaggcgtgcgatggcgttttagttgggactgcaagttgg
aatgaagaagccttttgcgagatgattcgcattgctgatagtgtcaaaaaataa

DBGET integrated database retrieval system