KEGG   Sulfurospirillum barnesii: Sulba_0550Help
Entry
Sulba_0550        CDS       T02139                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sba  Sulfurospirillum barnesii
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sulba_0550
  Amino acid metabolism
   00300 Lysine biosynthesis
    Sulba_0550
Enzymes [BR:sba01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Sulba_0550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
512345..513457
Genome map
AA seq 370 aa AA seqDB search
MIKTDELFLKLLRCVSITPEEGGSFSLIREYLNDFEAIEVNVEETKNLFLYKRFGEGPHL
CFAGHLDVVPPGQGWQSDPFEPVVKEGVVYARGAQDMKSGVCAFVQALKQTKTFNGTLSA
LLTSDEEGDAKHGTIEVLKLLKERSFLPDYAIVAEPTSEKVFGDAIKVGRRGSINGVIEI
RGKQGHAAYPEKAINPVHQIAPVLSKLAGHQLDAGDEFFAPSMMVITDIRGGMEVSNVTP
QNLKIMFNVRNSTKTTAEAIDAYVKEVLNGLDFTLCLNQTAHPFVTCKDALIVKAVEKAL
LHVTHHSPKLSTAGGTSDARFFGAFGVATIECGVVNDTIHAPNECCPLSEVESLEAVFNH
VIENFTKEEQ
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaacagatgaactttttttaaaacttttacgatgtgtttcgattacacccgaa
gagggtggctcattttcgctgatacgagagtatttgaatgattttgaagcgattgaagtg
aatgtggaagagacgaaaaatctttttttatacaaacgttttggggaagggccacatctt
tgctttgcggggcatcttgatgtggttcctccagggcaaggctggcagagtgatcctttt
gagcctgtggtgaaagagggtgtcgtgtatgccagaggagcgcaagatatgaaaagtggc
gtgtgtgcttttgtacaagcgcttaaacagacaaaaacctttaatggtacactctcagcc
cttttaacgagtgatgaagagggtgatgcgaagcatggaacgatagaggtgcttaagctt
ttaaaagagcgttcatttttgcctgattatgccattgtggcggaaccaacatctgagaaa
gtgtttggcgatgcgataaaagtaggacgaagaggttccattaatggagtgattgagata
agagggaagcaggggcatgcggcttatcctgaaaaagccatcaaccctgtgcatcaaata
gctcccgttttatcaaaacttgcaggacatcaactcgatgcaggagatgaattttttgca
ccttcaatgatggttatcaccgatataagaggcggtatggaagtgagcaatgtcaccccg
caaaatttaaaaattatgtttaatgtacgaaactccaccaaaacgacggctgaggcgatt
gatgcgtatgtgaaagaggttttaaacgggcttgattttacgctatgtttgaatcaaact
gcacatccttttgttacatgtaaagacgctttgattgttaaagcggttgaaaaagcactc
ttacatgtaacgcaccattcgcctaaactttccacagcaggtggcacaagcgatgcacgc
ttttttggtgcatttggtgtagcaacgattgaatgtggcgtggtcaatgacaccattcat
gcccccaatgagtgttgtcccttaagtgaagtagaatctcttgaagccgtttttaaccat
gtgatagaaaattttacaaaggaagaacaatga

DBGET integrated database retrieval system