KEGG   Sulfurospirillum barnesii: Sulba_0627Help
Entry
Sulba_0627        CDS       T02139                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sba  Sulfurospirillum barnesii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sba00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sulba_0627
DNA repair and recombination proteins [BR:sba03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Sulba_0627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
587599..588165
Genome map
AA seq 188 aa AA seqDB search
MRGLEKFNKLVDAFEKLPTVGRKSALRFAYHLVLNDTFSAMKLSNAIESAIKSIRKCERC
GALSEHEICDICLDERRDGAKICVVESAKDIFILEEHKLFDGKYFVLCNLDETTLEQLEK
IVKEGAKELIFALTPSLANDALIMYIEDKLKMYALQFTKIAQGVPTGVHLENVDMLSLSK
ALEARTKI
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgcggggacttgaaaagtttaataagcttgtggatgcctttgaaaagcttccaacggta
ggtcggaaatctgctcttcgttttgcgtatcatttggttttaaacgatacgttttctgca
atgaaactctccaatgcgattgaaagtgccattaaaagtattcgtaaatgtgaacgctgt
ggtgctcttagtgagcatgaaatatgcgatatttgtctggatgagaggcgcgatggtgcc
aaaatatgtgtggtggaaagtgccaaagatatttttattttagaggaacataaactcttt
gatgggaaatattttgtgctgtgcaatttggatgagacaacccttgaacagctcgaaaag
attgttaaagagggcgcaaaagagcttatttttgcactcacaccctctttggccaatgat
gcgcttattatgtacattgaagataaactaaagatgtacgccttgcaatttaccaaaatt
gcacagggtgttccgacaggggttcatcttgaaaatgtcgatatgctctccctctccaaa
gcccttgaagctcgaacaaagatttaa

DBGET integrated database retrieval system