KEGG   Sulfurospirillum barnesii: Sulba_0627Help
Entry
Sulba_0627        CDS       T02139                                 

Definition
(GenBank) DNA replication and repair protein RecR
  KO
K06187  recombination protein RecR
Organism
sba  Sulfurospirillum barnesii
Pathway
sba03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sba00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sulba_0627
DNA repair and recombination proteins [BR:sba03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Sulba_0627
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Sulba_0627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RecR Toprim_4 zn-ribbon_14 BRCT RE_MjaI ALAD
Motif
Other DBs
NCBI-ProteinID: AFL67935
UniProt: I3XVG1
Position
587599..588165
Genome map
AA seq 188 aa AA seqDB search
MRGLEKFNKLVDAFEKLPTVGRKSALRFAYHLVLNDTFSAMKLSNAIESAIKSIRKCERC
GALSEHEICDICLDERRDGAKICVVESAKDIFILEEHKLFDGKYFVLCNLDETTLEQLEK
IVKEGAKELIFALTPSLANDALIMYIEDKLKMYALQFTKIAQGVPTGVHLENVDMLSLSK
ALEARTKI
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgcggggacttgaaaagtttaataagcttgtggatgcctttgaaaagcttccaacggta
ggtcggaaatctgctcttcgttttgcgtatcatttggttttaaacgatacgttttctgca
atgaaactctccaatgcgattgaaagtgccattaaaagtattcgtaaatgtgaacgctgt
ggtgctcttagtgagcatgaaatatgcgatatttgtctggatgagaggcgcgatggtgcc
aaaatatgtgtggtggaaagtgccaaagatatttttattttagaggaacataaactcttt
gatgggaaatattttgtgctgtgcaatttggatgagacaacccttgaacagctcgaaaag
attgttaaagagggcgcaaaagagcttatttttgcactcacaccctctttggccaatgat
gcgcttattatgtacattgaagataaactaaagatgtacgccttgcaatttaccaaaatt
gcacagggtgttccgacaggggttcatcttgaaaatgtcgatatgctctccctctccaaa
gcccttgaagctcgaacaaagatttaa

DBGET integrated database retrieval system