KEGG   Sulfurospirillum barnesii: Sulba_0650Help
Entry
Sulba_0650        CDS       T02139                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sba  Sulfurospirillum barnesii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sba00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
611028..611672
Genome map
AA seq 214 aa AA seqDB search
MGIKSAPIYLFSDQSHEGVEHLPLFEIVFTSSSPRLEEVDAIIFTSKNSVKALELCGVYW
QDKACYAIGEGTAAAIRACGGNLLFTCKHSYGDLFAHELIPLLKDKRVFFPRAKEVISPL
FEILHSAGVTIFQEIMYETLCRHYAPVYAPAKNAILIFTSPSTVHCFLKNFSWDESYRTI
VIGTKTAAVLPLHVKPIIAEVQTIAHCVALAKAL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgggaataaaatctgctcctatctacctctttagcgaccaatcgcatgaaggggtagag
catttgcctctatttgaaatcgtttttacctcctcatcccctaggcttgaagaggttgat
gcgattatttttacctccaaaaatagtgtcaaagcacttgaactgtgtggcgtatattgg
caagataaagcgtgttatgccataggggagggaacagctgctgccatacgtgcctgcggc
ggcaatcttctctttacatgtaaacactcctatggtgatctttttgcgcacgaactgatt
cctttattgaaagataaacgtgtttttttcccacgtgccaaagaggttatttcgccttta
tttgaaattttacactcagcaggtgtcactatttttcaagaaattatgtatgaaacactc
tgtagacactatgcccctgtttatgcacctgctaaaaatgctattcttatcttcacatct
ccctcaacagtccattgctttttaaagaatttttcatgggatgagagttatcgtactatc
gtgattggtacaaaaacagcagcggttttacccttacatgtaaaacctatcattgccgaa
gtgcaaacgatagcgcattgcgttgcattggcaaaagctctttag

DBGET integrated database retrieval system