KEGG   Sulfurospirillum barnesii: Sulba_0890Help
Entry
Sulba_0890        CDS       T02139                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sba  Sulfurospirillum barnesii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sulba_0890
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sulba_0890
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sulba_0890
Enzymes [BR:sba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sulba_0890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(864948..866153)
Genome map
AA seq 401 aa AA seqDB search
MYIPKASKFDPDHNGHFGIFGGRYVPETLMPVLLELEREYQNLRFNEHFWSEVDGYLKEY
VGRPSSLYFAKNISQEIGAKVYLKREDLNHTGAHKINNTIAQGLIAKKMGKKRVIAETGA
GQHGVATATVAALLGLECEIFMGEKDVERQELNVFRMKLMGAKVHAVKSGSRTLKDAMND
AIRYWVTHARDTFYIIGTVAGPHPYPMMVRDFQAVIGYEAKAQILVKEKRLPDYVIACIG
GGSNAMGIFNHFLGEEGVRCIGIEAGGLGIDTDKHGCSLAKGSPGVLHGQMSYLLQDDEG
QVLEAHSISAGLDYPGIGPEHAYLKELGAATYDNITDKEALDAFVWLSRKEGIIPAFESA
HAIAYLKKMAKEEIKNKIIIVNLSGRGDKDMVQAKSLLEIG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtatattcctaaagcttcaaaatttgaccctgatcacaatggacactttggtattttt
ggtgggcgttacgttcctgaaacgcttatgcctgttttattagaacttgaaagagagtac
caaaaccttcgttttaatgaacacttctggtctgaagtcgatggatacctcaaagagtat
gtgggtcgtccctcttctttgtattttgcaaaaaatatttcacaagagattggtgcaaaa
gtctatttgaaacgtgaagatttaaaccatacaggtgcccacaaaattaataacaccatt
gcacaaggcttaatcgcaaaaaaaatgggtaaaaagcgtgttattgcagaaacaggagca
ggacaacatggcgttgcaactgctaccgttgcagcacttttaggtcttgaatgtgaaatt
tttatgggtgaaaaagatgtggagcggcaagagctcaatgtctttcgcatgaaacttatg
ggtgctaaagtgcatgcagttaaaagtggtagtcgcacattaaaagatgcgatgaatgac
gctattcgctactgggtcacacacgcacgtgatacgttttatattattggaaccgttgca
ggaccgcatccctaccccatgatggtacgtgattttcaagcggtcattggctatgaagcc
aaagcacaaattttagtcaaagaaaagcgtctccctgattatgtgattgcgtgtattggt
ggaggcagcaatgccatgggaatcttcaaccactttctaggtgaagaaggggtgagatgt
attggcattgaggcgggaggtcttggcatagatacggataagcatggctgttctctggca
aaaggaagccctggtgtgcttcacggacagatgagctatttattgcaagatgacgagggg
caagttttagaagcacactctatttctgcagggcttgactatcctggtattgggccagaa
cacgcttacttaaaagaattaggtgcagcaacctatgacaatattaccgataaagaagcc
ttagatgcgtttgtctggttaagtcgtaaagaaggcattattcctgcatttgaaagtgct
catgctattgcatatttaaagaaaatggcaaaagaagagattaaaaacaaaattattatc
gtcaatctctcagggcgtggcgataaagatatggtacaagcaaaatcccttctcgaaata
ggataa

DBGET integrated database retrieval system