KEGG   Sulfurospirillum barnesii: Sulba_1165Help
Entry
Sulba_1165        CDS       T02139                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sba  Sulfurospirillum barnesii
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sulba_1165
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sulba_1165
   00640 Propanoate metabolism
    Sulba_1165
   00660 C5-Branched dibasic acid metabolism
    Sulba_1165
Enzymes [BR:sba01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Sulba_1165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1131962..1133137
Genome map
AA seq 391 aa AA seqDB search
MNIHEYQAKEIFRRYNVPTPRGYVASSVEEAVQNAQKLGGTLWVVKAQIHAGGRGLGGGV
KLARSLDEVKAHAQALLGMNLVTHQTTALGTCVQKIYIEEGVEIANEFYLGMVLDRSQEL
PVMMASCEGGMEIETIAQSAPEKIIKVSIDPFIGFQSYHGRELAFGLNLPQEETQNFIHC
AKALYEAYMHNDASMIEINPLVKTKNGTFIALDAKMSFDDNALFRHPEIVAMRDTSEENP
IEREASEYGLSYVKLNGSVGCMVNGAGLAMGTMDIIDYAGGEPANFLDVGGGANANTVAK
GFEIILKDPNVKSIFVNIFGGIVRCDRIANGILEATKMVKVDVPVIVRLDGTNAKEAVEI
LKNANIKNIISATDLSDGAQKAVAAAKGALV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgagtatcaggccaaagagatttttaggcgctacaatgttccaacgcca
cgtgggtatgttgctagcagtgttgaagaagcagtgcaaaatgcacagaaactaggcggc
acgctgtgggtagtcaaagcacaaattcacgcaggtggcagaggtttgggaggcggtgtt
aaattagcacgaagcctagacgaggtcaaagcgcacgcacaagcacttcttggtatgaac
cttgtgacgcatcaaacaacagctttgggaacatgtgtccaaaaaatctatatcgaagag
ggtgtggagattgcgaatgagttttatttagggatggttttagaccgctctcaagagttg
cctgtcatgatggcatcgtgtgagggaggcatggaaattgaaacgattgctcagagtgca
cctgaaaaaattatcaaggtcagtatcgatccttttattggttttcagtcatatcacgga
cgagagcttgcctttggtttaaatttaccgcaagaagagacacaaaattttattcactgt
gctaaggctttgtatgaagcatatatgcacaatgatgcctcaatgatagaaattaatcct
ttagtcaaaacgaaaaacggaacatttattgcccttgatgcgaaaatgagttttgatgac
aatgctctttttcgtcatcctgaaattgtggcgatgcgtgatacgagtgaggaaaatcct
attgagagagaagcctcagagtatgggttgagttatgttaagttgaatggttctgtaggg
tgtatggtcaatggtgcaggtttggcgatgggaaccatggatattattgattatgcaggg
ggcgagcctgcaaacttcttagacgtgggtggtggggcaaatgccaataccgttgcaaaa
gggtttgagattatcttaaaagacccaaatgtgaagtccatttttgtgaatatttttggt
ggtattgttcgttgtgatcgcattgctaatggtattttagaagcgaccaaaatggtaaaa
gtggatgtacctgtgattgttcgtttggatggcaccaatgccaaagaggcagttgaaatt
ctcaaaaatgcaaatattaaaaatattatcagtgctacagatttaagtgatggagcacaa
aaagcagttgctgccgcaaaaggagcgttggtatga

DBGET integrated database retrieval system