KEGG   Sulfurospirillum barnesii: Sulba_1195Help
Entry
Sulba_1195        CDS       T02139                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sba  Sulfurospirillum barnesii
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sba00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:sba00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1159875..1160960
Genome map
AA seq 361 aa AA seqDB search
MRRITLVFIGLFFYSLPLHAMPEDEALKKMIGHMLIVGFEEEKLVATSPIVEAIERYELG
GVILFDRFYTDKSRVKNIRSSEQLKALTHTLKASAKTPLLICVDQEGGKVARLKPSYGFV
QTPSALKVASESLEKAKETYDALALMLREHGINCNFAPDVDLSLNPKNSVIVGLERSYGT
EPHRVVSYAGVMLESFVEHNITGVLKHFPGHGSSFEDSHLGFVDVTQTWSEVELDPYRML
IAQEKASMIMSAHVFNAKLDKNYPATLSYATNTLLLRQTLGFKGVLVSDDMHMQAIANDY
SLKDAITLAINSGVDMLLFGNQLSYTSTHEIIETIATQVKSGAISLQRIREANTRIEHLR
H
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcagaatcactcttgttttcatagggttgtttttttattcattgccactgcatgcg
atgccagaggatgaagctttaaaaaagatgatagggcatatgcttatcgtgggttttgag
gaagaaaagctggttgccaccagccctattgtggaagcaattgagcgttatgagctgggg
ggagtcattttgtttgaccgcttttatactgataaaagtcgtgttaaaaatattcgctcc
tcagaacaactcaaagcactcacacatacgcttaaagcttctgctaaaacacctctgctc
atttgtgtggatcaagaaggtggaaaggtggcacggctgaaaccttcttacggttttgtg
caaacgccctctgcattaaaagtagcaagcgagtcattggaaaaagccaaagagacgtat
gacgctttagcgttgatgctgcgtgaacatggtattaattgtaattttgctcctgatgtg
gatctttctcttaatcccaaaaacagtgttatcgtaggtttggagcgctcgtatggcaca
gagccacaccgtgttgtttcgtatgcgggagtgatgttagaatcctttgtggagcataat
attacgggtgtgctcaagcattttccaggacatggctcctcctttgaggattcacatttg
ggatttgtcgatgtaacgcaaacgtggagtgaagtagaattagacccctatcgaatgctt
atagcacaagagaaagcctcaatgattatgtcagcacatgtttttaatgcaaagcttgat
aagaactatcctgcaacgctttcgtatgcgaccaatacgcttttgctaagacaaacgcta
ggctttaagggtgtgttggtcagtgatgatatgcacatgcaagccattgcgaacgattac
tccctaaaggatgccataaccttagccattaattcaggggtggatatgcttctttttggc
aatcagctctcatacacatctacccatgagattattgagacgattgccacacaagtcaaa
agtggtgctatttcactgcaacgtattcgtgaagccaatacgcgtatagaacacctaagg
cattaa

DBGET integrated database retrieval system