KEGG   Sulfurospirillum barnesii: Sulba_1213Help
Entry
Sulba_1213        CDS       T02139                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sba  Sulfurospirillum barnesii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sba00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sulba_1213
Enzymes [BR:sba01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Sulba_1213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1181850..1182410
Genome map
AA seq 186 aa AA seqDB search
MIVGIEGSVVKKEVTSVCIKTASGLSYKVFVSLFSISKINKNETISLHVSQIIREDQHSL
YGFIDENEQKVFDTLIKLNGIGPSTALAICSTLSPDDFAGALLSQNISAFQKVPGIGPKS
AKRILVELSDFSLQLLNDEHSNSSMQEASMALESLGFKKEMIRKVLSTLQGNDTQSIIKE
ALKKLS
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgggcattgagggaagtgttgtcaaaaaagaagtgacatcggtttgcattaag
acggcttcaggattaagttataaagtgtttgtctcactctttagtatttcaaaaattaat
aaaaatgaaacaatttctttacatgtaagtcagattattcgtgaagatcagcacagtttg
tatggttttatagatgaaaatgaacaaaaagtttttgataccttgattaaacttaatggt
attggtccttccaccgcccttgccatctgttcaaccttaagccctgatgattttgcgggg
gcactgctttctcaaaatattagtgctttccaaaaagttccaggcattggtccaaagagt
gcaaaacgtattttggtggagctgagtgatttttcattgcaattgttgaacgatgaacat
agcaatagcagtatgcaagaagcctctatggcgcttgagagtttaggatttaaaaaagag
atgattcgtaaagttttaagcacacttcaagggaacgatacccaaagtattattaaagaa
gcgctgaaaaagctttcataa

DBGET integrated database retrieval system