KEGG   Sulfurospirillum barnesii: Sulba_1294Help
Entry
Sulba_1294        CDS       T02139                                 

Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sba  Sulfurospirillum barnesii
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sulba_1294
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sulba_1294
Enzymes [BR:sba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Sulba_1294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1258840..1259628
Genome map
AA seq 262 aa AA seqDB search
MILDEIIKRTHEDLEKKKKEYTIDWLGRSLAFNPFMPRDVKPYLKATPQNPYRIIAEVKK
ASPSKGIIKEDFDPLLIAKAYELGGADAISVLTEPHYFKGNLEYLTQIRRYVPTPLLRKD
FIIDEYQILEALVYGADFILLIAKALSKAELKHLLEYALRLGLEVLVEIHDKEDLVKAIF
AGANIIGINHRNLETFEMDMNLTQKLMPLIPQGKIIVAESGLNDKETIKHLSQMGADAFL
IGEYFMRENDIETSLKSFKKVD
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgattttagatgaaattataaaacgtacccatgaagacttagaaaagaaaaagaaagaa
tacaccatagattggctaggcaggagccttgcctttaatccgtttatgccacgcgatgtt
aaaccgtatcttaaagcaacaccccaaaatccgtatcgtattattgcagaagttaaaaaa
gcaagccctagcaagggaattattaaagaagattttgaccctttactcattgccaaagcg
tatgagttaggaggggcagatgcgatttctgtgctgactgagccacactattttaaaggt
aatttagagtatttaacccaaatccgccgttatgtaccaacaccgctgttgcgaaaagat
tttattattgatgagtatcagatacttgaagcccttgtttacggcgccgatttcatttta
ttgatcgcaaaagcactttcaaaagctgagttaaaacacctattagagtatgcattacga
ctaggactggaagttttagtcgaaatacatgataaagaggatttggtcaaagccattttt
gcaggagcgaatatcatcggtataaaccaccgaaatttagagacctttgagatggatatg
aacttaacccagaagcttatgccactgattcctcaaggaaagatcatcgtagcagagagt
ggattgaacgataaagagacgattaaacacttaagtcagatgggagcagatgcgttttta
attggagaatattttatgagggaaaatgacatagaaacatctctaaaatctttcaaaaag
gtagactaa

DBGET integrated database retrieval system