KEGG   Sulfurospirillum barnesii: Sulba_1414Help
Entry
Sulba_1414        CDS       T02139                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sba  Sulfurospirillum barnesii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sulba_1414
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sulba_1414
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sulba_1414
Enzymes [BR:sba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sulba_1414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1385694..1387178
Genome map
AA seq 494 aa AA seqDB search
MFIETRGNDGKKSQKVPFSYAILNPSASFGGLYVPENLPNIDTDFLEKASKKSYKEITLD
ILRLFNIDIEEEVMQKAVALYDAFDDATEPTPLVQIEDDLFVNELYHGPTRAFKDMALQP
FGYILSHLAQKLGEQYLILAATSGDTGPATLDTFANKPNIKVVCLYPDGGTSDVQRLQMT
TQKSPNLKIIGIHGNFDDAQNALKNLLASPSFKEALSAKDIKLSAANSVNFGRIIFQIIY
HIYAYVALLKQGKVALGKPFYTIIPSGNFGNALGAYYAKKMGLPIQKILIASNINNILTD
LISTGVYDLRSRTLLQTTSPAMDILISSNVERVLFDKFGAERTKELMEALKEDKLYTLTQ
KELACIQDDFEAVYCDDTFGKEQIKHYANKGYIMDPHTATCLKAYKELKIKPLPCVLCST
AEWTKFAPTMLNAIKEDSVTYSDKEALEGISNALHVKIPECIRALFNEAIIHDSVVKKEK
IEAEIFDFLNKVKP
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtttattgaaacccgtggaaacgatggaaaaaaatcacaaaaagtccccttctcctat
gctattttaaatcctagtgctagctttggtggactttatgtacctgagaacttacctaac
attgatactgactttttagaaaaagcttccaagaaaagctataaagagattacgctggat
attttaagactcttcaacattgacattgaagaagaggtcatgcaaaaagcggttgccttg
tatgatgcatttgatgatgctactgagccaacacctttggttcaaatcgaagacgacctt
tttgtcaatgaactctaccacggtcctacacgtgcttttaaagatatggccttacaaccg
tttgggtatattctttcacaccttgcacaaaagctaggtgagcagtatctcattttggcg
gcaaccagcggtgacacgggacctgcaacgctggatacctttgccaataagccaaacatc
aaagtggtttgcctttatcccgatgggggaaccagtgatgttcaacgcttacagatgacc
acacaaaagagtccaaaccttaaaattatcggtattcatggcaattttgatgatgcccaa
aatgcgctcaaaaacctgcttgcatcgcctagtttcaaagaagcactcagtgctaaagat
attaaactcagtgcagcaaactcggtcaattttggacgtattatttttcaaattatctac
catatctatgcctatgtcgcccttcttaaacaaggcaaggttgcgcttggaaaacctttt
tacaccattattcctagtggcaattttggaaatgccttaggggcgtattatgcgaaaaag
atgggcttacccattcagaaaattttgattgcttctaacatcaacaatattttaaccgat
ctgattagcacaggtgtttatgacttgcgaagccgaacacttttacagaccacctctcct
gcgatggatattctcatttcctccaacgtagaacgtgttttgtttgacaaatttggagca
gaacgtacgaaagagctgatggaagcactgaaagaagataaactctatacactcacacaa
aaagaattagcgtgcatacaagacgattttgaggcggtttattgcgatgatacctttggc
aaagagcaaattaagcactatgccaacaaaggctacattatggacccgcatacggcaacg
tgtcttaaagcctacaaagagcttaaaataaaaccacttccgtgtgttctatgctcaaca
gctgagtggacaaaatttgcgccaacgatgttgaatgctatcaaagaagacagtgtcaca
tacagcgataaagaagcacttgaaggtatcagcaacgctttacatgtaaagattcctgag
tgcattcgtgccttatttaatgaagccattattcacgatagcgtggttaaaaaagagaag
attgaagcagaaatttttgactttttaaacaaggttaagccatga

DBGET integrated database retrieval system