KEGG   Sulfurospirillum barnesii: Sulba_1698Help
Entry
Sulba_1698        CDS       T02139                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sba  Sulfurospirillum barnesii
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sba00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sulba_1698
Enzymes [BR:sba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Sulba_1698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1672392..1673165)
Genome map
AA seq 257 aa AA seqDB search
MQYEAHAKVNIFLKIVGIRGNYHELFSRFMLVSHLFDTLSFVPKSSRMPFELVGDFNCAL
EQNTVYKIFQTLQKHGFDTEIQNVMHHEALHVNKRIPSGAGLGGGSSDAATFLKMLNDRA
DLKLSAEDMMALGAEVGADVAFFASGYTSANVRGIGEKVEAYDEAPLDLDVFTPPLACDT
ARVYRTYREYFLQFINPSLAASMVDMSSEALLQSFGKEELNDLYPACLQAYPELRSYEKE
GWFFSGSGSSFFRMKEK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatgaagcacatgctaaagtcaatatttttttgaaaattgtaggaattcgtggc
aattaccacgaattgttttcacgctttatgcttgtttctcatctgtttgatacgttgagt
tttgtaccgaaatcatctcgtatgccttttgagttggtgggggattttaactgtgcttta
gagcagaacactgtgtataagatttttcagactttgcaaaaacacggttttgatacagag
atacaaaatgtcatgcaccatgaggcgttacatgtaaacaaaagaatcccctcaggtgca
gggcttggaggtggcagtagtgatgctgccacatttttaaaaatgctcaatgatcgggca
gatttaaaattgagtgctgaggatatgatggcattgggtgctgaggtgggtgcggatgta
gcattttttgcctcagggtatacgagtgccaatgtcaggggtattggtgaaaaggtagaa
gcttatgatgaagcgccattggatttggatgtttttacgccaccacttgcgtgtgatact
gctcgtgtgtatcgtacgtacagggaatattttttgcaattcatcaatccttctttggcc
gcatctatggtggatatgagcagtgaggctttgctgcaaagttttggcaaagaagaactg
aatgatttgtaccctgcttgtttacaggcgtatcctgagcttaggtcatatgaaaaagag
ggatggttttttagtgggagtggtagcagtttttttagaatgaaagagaaatag

DBGET integrated database retrieval system