KEGG   Sulfurospirillum barnesii: Sulba_1885Help
Entry
Sulba_1885        CDS       T02139                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
sba  Sulfurospirillum barnesii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sulba_1885
   00030 Pentose phosphate pathway
    Sulba_1885
   00051 Fructose and mannose metabolism
    Sulba_1885
   00052 Galactose metabolism
    Sulba_1885
   00500 Starch and sucrose metabolism
    Sulba_1885
   00520 Amino sugar and nucleotide sugar metabolism
    Sulba_1885
  Nucleotide metabolism
   00230 Purine metabolism
    Sulba_1885
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sulba_1885
Enzymes [BR:sba01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Sulba_1885
    5.4.2.8  phosphomannomutase
     Sulba_1885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1859633..1861003)
Genome map
AA seq 456 aa AA seqDB search
MKTIFREYDIRGIYEKELNEQMVKLIGYFLGKQIVKVGKVVSIGYDARSHSPILCEYLTS
GLNKAGCKVLNMGLVATPVNYFSNFQTFNGTTPNASIMITGSHNPSEYNGFKITIDKKPF
FGEDIYALGREIMQNYAMEIEDDFSASFIDAKERYIAYMIQEFDHLKGFDKPFVYDCGNG
VAGVVVQDIFKALNFTCKGLFVDPDGTFPNHHPDPTVEKNLKDIKKELEGEFELGFAYDG
DADRIAFLTKKNNVKGDIMAILFSRAMKNPTVIGEVKCSQIMYDDINARGKAIMYKTGHS
NLKVMIAKTNADFAAEVSGHLFFNDRYFGYDDAIYATLRMIELVKNGLDVDGEIAKLPVV
YSTEELKVETNENDKFPLVDKVKELLKNPPADFPAIKEIVDVDGVRVIFSDGWGLVRASN
TTPVLVTRFESTNESNAKLYEQKLNEIIAMAKAELH
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaatttttagagagtatgatattcggggcatttacgaaaaagagctcaatgag
cagatggtaaaactcattggatattttttaggaaagcaaattgtaaaggtaggaaaggtg
gtttctattggttatgatgcccgttcgcactctcctattttgtgcgaatacctcacaagt
gggctgaacaaagcaggctgtaaagtcctcaatatgggacttgtggcaacccctgtgaat
tactttagcaattttcaaactttcaatgggacaaccccaaatgcttctattatgataaca
ggctcacacaatcctagtgagtacaacggttttaaaattaccattgataaaaagcctttt
tttggcgaagatatttacgcattgggtcgtgagattatgcaaaactatgccatggaaatt
gaggatgattttagcgcctcgtttattgatgcgaaagagcgttacattgcttatatgatt
caagagtttgaccaccttaaaggttttgataaaccgtttgtgtatgactgtggaaatggc
gttgctggggttgttgtacaagatattttcaaagctttgaactttacatgtaaagggttg
tttgttgatcctgatggcacgtttccaaatcaccatcccgacccaacggtggagaaaaat
cttaaagatattaaaaaagagctagaaggggaatttgaactgggttttgcctacgatggt
gatgcggatagaattgcctttttaacgaagaaaaacaatgtcaaaggcgacattatggcg
attttattctcccgtgccatgaaaaacccaacggtgattggtgaggtgaaatgctctcaa
attatgtacgatgacatcaacgcccgtggtaaggcgattatgtacaaaacggggcacagt
aacctcaaagtcatgatagcaaaaacgaatgcagactttgcggcagaggtgagcggtcat
cttttctttaacgatagatattttgggtatgacgatgccatttatgcgacccttcgtatg
atagagcttgttaaaaatgggttggatgtggacggcgaaatcgccaaattgcctgtggtg
tattctaccgaagagcttaaagttgaaaccaatgaaaacgataaatttcctttagtcgat
aaagtcaaagagcttcttaaaaatcctccagcagattttccagccattaaagagattgtg
gatgtggatggtgtacgagttatttttagtgatggttggggacttgtaagggcgagtaac
accacgcctgttttagtcacccgttttgaatcgaccaatgagagtaatgcaaaactgtac
gagcaaaagttaaatgaaattatagctatggctaaagcggagcttcattaa

DBGET integrated database retrieval system