KEGG   Sulfurospirillum barnesii: Sulba_2053Help
Entry
Sulba_2053        CDS       T02139                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sba  Sulfurospirillum barnesii
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sba00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Sulba_2053
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sulba_2053
Enzymes [BR:sba01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Sulba_2053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2036302..2037615)
Genome map
AA seq 437 aa AA seqDB search
MKIALENHAPFLHVTDNSAECDASTIFVSTDQNRSYAQKAIENGCVKIISAKECLSLLEI
EGKIKIIGITGTNGKTTTAAAIYSILLDVGKKVGLQGTRGCFINDVRIEEKSLTTPPILQ
TIKNLKMAVEQGCEYFVMEVSSHAIAQNRIDGLSFALKILTNVTQDHLDFHKSIEEYIAI
KSRFFEDESLKLINKDERNIRFNRTNAMSYGIEHPATYKILAYSLKEGISAAVSKIEKVY
EFESSMHGFFNLYNLLAAIGAVDMLKGASMEEICEAVSHFGGVEGRMQVVSQEPLVIVDF
AHTPDGMEKVLESMKERDVIVVFGAGGDRDRTKRPKMGAMAERYAKKIIVTSDNPRSENP
QTIIDEILSGMHAKESLHVKVDRYEAIEQALVMQGLNDVVLILGKGDETYQEIAGVKHPF
DDRVVVQEILARWAKQK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatagcattagaaaatcatgctccatttttacatgtaacggataattcagccgaa
tgtgatgcttcaacgatttttgtttcaacagatcaaaatcgctcttatgcgcaaaaagca
attgaaaatggatgtgtaaagattatttctgccaaagagtgtttatcacttttagagatt
gagggaaagattaaaattattggtataacaggtacgaatgggaagacgaccacagcagct
gctatttattctattttgcttgatgttggcaaaaaagtgggattacaaggcacacgtggt
tgttttatcaatgatgtgcgtattgaagagaagagtttaacgactcctcctattttgcaa
acgattaaaaatttaaaaatggcagtagagcaaggatgtgagtattttgtcatggaagtg
agctctcatgcgattgctcaaaatcgtattgatggactcagctttgcactcaaaatttta
accaatgttacgcaagatcatttagattttcataagagcattgaggagtatattgctatt
aagagtcgtttttttgaagatgaaagtttaaagctcatcaataaagatgaacgtaatatt
cgctttaatcgcaccaatgctatgagttatggcatagaacatcctgcaacgtataaaatt
ttagcctattctttaaaagagggtatcagtgcagcggtttcaaaaattgagaaagtttat
gaatttgagtcatcaatgcatggttttttcaatctttacaatcttttagctgccattggc
gctgtggatatgttaaaaggtgcgagtatggaagagatttgcgaagcagtttcgcatttt
ggtggtgtggagggacgcatgcaagtggtttcacaagagccattggtcattgttgatttt
gcacacacgcctgatgggatggaaaaagttttagagagtatgaaagagcgtgatgtgatt
gtcgtttttggagcaggaggcgatagggatcgcacgaagcgtcctaaaatgggggcaatg
gcagaacggtatgctaaaaagattattgtcaccagtgacaatccacgttctgaaaatcct
cagaccatcattgatgaaattttaagtggcatgcatgccaaagaatctttacatgtaaag
gtagatcgttacgaagctattgagcaagcgcttgtaatgcaagggttgaatgatgtggtg
cttatccttggaaaaggggatgaaacctatcaggagattgcaggggtgaagcatcctttt
gatgatagggttgtggttcaagagattcttgcacgatgggctaagcaaaaatag

DBGET integrated database retrieval system