KEGG   Sulfurospirillum barnesii: Sulba_2100Help
Entry
Sulba_2100        CDS       T02139                                 

Definition
(GenBank) chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
sba  Sulfurospirillum barnesii
Pathway
sba02020  Two-component system
sba02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sba00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sulba_2100
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Sulba_2100
Enzymes [BR:sba01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Sulba_2100
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Sulba_2100
Two-component system [BR:sba02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Sulba_2100
Bacterial motility proteins [BR:sba02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Sulba_2100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg TAL_effector
Motif
Other DBs
NCBI-ProteinID: AFL69379
UniProt: I3XZK5
Position
complement(2067724..2068749)
Genome map
AA seq 341 aa AA seqDB search
MIKVLIVDDSATARHVLHDILSSDARIEVVGLAADAYIARDMIVALSPDVICLDIEMPRM
DGLTFLQKLMLHYPTPVVIVSSLSSSSARVTLDAFEAGAVDFVQKPHAYLFDGKNEIQEE
LIQKVLNASHAKVQRKALPSKEHGGIRLSTTTQKVIAIGSSTGGTEALKVVLRAMPSNAP
AILVVQHMPQAFIPAFAKRLDELCAIDVKVARHGDALQQGVAYIAQGNKHMVLRRFAARY
SIEIGVGKRVSGHCPSVDVLFNSVSKAAGENALGVILTGMGSDGARGIYNMHQAGAKTIA
QSEESCVVFGMPKEAIRLGGIDEIVPLEGIAHTVINMLNQE
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgattaaggtcttaattgtggatgacagtgccactgcacggcatgttttacacgatatt
ttaagctcagatgctcgtattgaagtggtaggattggctgcagatgcgtacatcgcacgg
gatatgattgtggctctttcgcctgatgtgatttgtttagacattgaaatgcctcgtatg
gatggcttaacttttttacaaaaattgatgttgcattatcccactcctgtggtgattgtc
tcatcgttaagcagtagcagtgcaagagtgacactggatgcgtttgaagcaggggcagtg
gattttgttcaaaaacctcatgcttatttatttgatggaaaaaatgagattcaagaggag
ttaattcaaaaagtactgaatgcttcgcatgcaaaggttcaacgaaaggctttaccttct
aaggagcatggagggattcgcctgagcacaaccacgcaaaaagtaattgccattggctca
agtacaggaggtacggaggcgttaaaggttgtattgcgtgcgatgccctccaatgctcca
gctattttagtggtacaacacatgcctcaggcatttattcctgcgtttgcaaagcgtttg
gatgagctgtgtgctattgatgtgaaagtagcacgccatggagacgctttacaacaaggt
gtggcatacatcgcacaaggtaataaacatatggtgcttcgccgttttgctgcacgctat
agtattgaaataggcgtaggaaagcgggtgagtgggcattgtcctagtgtggatgtattg
tttaattctgtctctaaggctgcgggtgaaaatgcattgggtgttattttaacaggtatg
ggcagtgatggggcacgaggcatttacaatatgcatcaagcaggggcgaaaaccattgct
cagtccgaagagagttgtgtggtctttggcatgccaaaagaggcaattaggctgggagga
attgatgaaattgttccacttgaagggattgcacatacggtgattaatatgttaaatcag
gagtag

DBGET integrated database retrieval system