KEGG   Sulfurospirillum barnesii: Sulba_2234Help
Entry
Sulba_2234        CDS       T02139                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
sba  Sulfurospirillum barnesii
Brite
Enzymes [BR:sba01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Sulba_2234
Secretion system [BR:sba02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Sulba_2234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2195477..2196196
Genome map
AA seq 239 aa AA seqDB search
MKKQILWFVALLSSTLFAATDAQIVEHFKSTIQVPNITIEVISRKKVDNIEGMDFVTLNL
SDGARSQKLSIFTKDDLIFPDVISIKQGGSIKEMMEMADLQKNLSALYKKEDKKNIVSLG
NDPKKETLVVFTDPECPYCRQELAQIEQRLTTNNIKLIFTPVHARTSLEKSVLVYKESAK
AKNDAEKIAILKKYFDETVSYEQKISDEEVGRIETLKQKYFGAGIKGVPFMVREKELLK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacagattttatggtttgttgcactgctttctagcacactttttgcagcaaca
gacgcacaaattgttgaacacttcaaatcgacaattcaagttcccaatatcaccatcgaa
gttatctctcgtaaaaaagtcgataatatcgaaggtatggattttgtaacgcttaactta
agcgatggcgcgcgttctcaaaaattgagtatttttaccaaagatgacctcatcttccct
gatgtcattagtattaaacaaggcggaagcattaaagagatgatggagatggcagatctt
caaaaaaatctctcagcgctttacaaaaaagaagataaaaagaacatcgtctcattaggt
aatgatcctaaaaaagagactttagttgtctttaccgacccagaatgtccttattgcaga
caagaattagcacaaattgagcaaagacttacgaccaataacattaagctgatttttaca
cctgtacatgcacgtacttctttagaaaaatcagttttggtttacaaagagagtgctaaa
gcaaaaaatgatgcagagaaaattgctattttgaaaaaatactttgacgaaaccgtcagt
tatgagcaaaaaatcagtgatgaagaagttggacgcattgaaacactcaaacaaaaatat
tttggcgcaggcattaaaggggttccttttatggtgcgtgaaaaagagcttttaaaataa

DBGET integrated database retrieval system