KEGG   Shewanella baltica BA175: Sbal175_0069Help
Entry
Sbal175_0069      CDS       T02014                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
sbb  Shewanella baltica BA175
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sbal175_0069
Enzymes [BR:sbb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Sbal175_0069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(78690..80168)
Genome map
AA seq 492 aa AA seqDB search
MKNQVQLITYVDRITNAGLKELKALLDDELQGLFGGVHLLPFYFPIDGSDAGFDPIDHVQ
VDSRLGNWDDVKRIGDDYDIMADLIVNHMSAESPEFKDVLQHGKQSAYWDLFLTKDKVFP
EGLSEQDQAAIYRPRPGSCFSTYTLADGSTEEFWTTFTRNQIDIDVHSAAGKDYLNRVLA
RFDHSKVNLIRLDAAGYAIKKPGTSCFMIEESFEFVDKLAKQANALGMTTLAEIHSHHMT
QVEIAKRVDMVYDFALPPLILHTLFSQDCQALTHWLEMAPRNCITVLDTHDGIGIIDVGP
MDGLRGLLTENQIDNLVETIHGNSKGESLQATGAAASNVDLYQINCTYYDALGQNDLDYL
MARAIQFFAPGIPQVYYAGLLAIPNDMELLNNTHVGRDINRPYLNREKVQQAMQKPVVKA
LTQLIKLRNSSPAFDGRFTMASAERTLTLSWTAADSQASLTLDFANKDGLIILLDKQGKE
TQVSLSKLLAQA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccaagtgcaactgatcacctatgtcgacagaattaccaatgcagggctcaag
gagctcaaagcgctactcgatgacgagttgcaaggtctattcggcggcgtacatcttttg
cctttctatttccccattgacggcagcgatgcgggcttcgatccgatagaccatgtgcaa
gtcgattcacgcttaggcaattgggatgacgttaaacgcattggtgatgactacgacatc
atggccgaccttatcgttaaccatatgtccgccgagtcacccgaatttaaagacgtgctc
cagcatggcaaacaatcggcttattgggatttgtttttaaccaaagacaaggtatttcct
gaggggttaagcgagcaagatcaagccgctatctatcgtccgcgtccgggaagttgtttt
agcacttacaccttagccgatggctcgaccgaagagttttggaccacctttacccgcaat
caaatcgatatcgacgttcattccgccgcgggtaaagattatttaaaccgagtgctagcg
cgcttcgaccacagtaaagtgaatctgatccgcttagatgctgcgggttatgcaattaaa
aagcccggcactagctgctttatgattgaagagtccttcgagttcgtggataagttagct
aagcaagccaatgcgttaggtatgacaacgctggccgaaattcattcgcaccacatgact
caagtcgaaatcgccaagcgggtcgacatggtgtacgacttcgctctgccaccgctcatc
ttgcacacgctgtttagccaagattgccaagccttgacccattggctggaaatggcgcca
cgcaactgcattaccgtactcgacacccacgacggcatcggcattatcgacgtcggccct
atggatggcttgcgcggattattgaccgaaaatcaaatcgataatctggttgaaaccata
catggcaacagtaagggcgagagtctacaagccacaggcgcggccgccagcaacgtcgat
ttgtatcaaatcaactgcacctattacgatgccctcggtcagaatgacctagattatttg
atggcgcgggcgattcagtttttcgcacccggtattccgcaggtgtattacgcgggtctg
ctggcgattccaaacgatatggagctgctcaacaacacccatgtcggtcgcgatatcaat
cgcccttacttgaaccgtgaaaaagtgcagcaagccatgcagaaacctgtcgttaaggcg
ctgactcagctgattaaactgcgtaatagcagcccagccttcgatggccgctttacgatg
gcatcagcagaacgcacgttaaccttatcttggacagcggccgattcgcaggcgagcctc
accctcgactttgccaataaagatggcctaataatccttttagataagcaaggtaaagag
acacaagtgtcgttatcaaaactgttggctcaagcataa

DBGET integrated database retrieval system