KEGG   Shewanella baltica BA175: Sbal175_0841Help
Entry
Sbal175_0841      CDS       T02014                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
sbb  Shewanella baltica BA175
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sbal175_0841
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Sbal175_0841
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sbal175_0841
Enzymes [BR:sbb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Sbal175_0841
Exosome [BR:sbb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sbal175_0841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(996812..998131)
Genome map
AA seq 439 aa AA seqDB search
MSFTKAPLLLLGISLLLSTPVWADETGPTKAPSRPKNIVIMIGDGMGPSYTSAYRYYKDN
PDTEEVEQTVFDRLLVGMASTYPASVSGYVTDSAAAATALATGVKSYNGAISVDTQKQPL
PTILEKAKSLGLSTGVAVTSQINHATPAAFLAHNESRKNYDALALSYLETNADVFLGGGQ
KYFPPALLEQFKAKGYQHISRFEDLASITQPKVLGLFAEVQLPWAIDEKDARKLSTLTQK
ALSLLSQNDQGFVLLVEGSLIDWAGHNNDIATAMGEMDEFSNAIEVVEQFVREHPDTLMV
ITADHNTGGLSIGVDGNYSWNPEILRNISASTDTLALAAITGEQWQADLARGLGFELSEE
EVAKLNVARMQGLETMAVAIRHVIDKRTDTGWTTDGHTGTDVQVFAAGPASELFNGHQDN
TDIANKIFSLLPKPKKPKS
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcaccaaagcgccactcttgttactcggcatcagtttgctgttatctacgcca
gtttgggcagatgaaacgggtccaacgaaagcgccatcgcgaccgaaaaatatcgtcatc
atgataggtgatggtatggggccgtcttacactagcgcctatcgctattacaaagataat
cctgacactgaagaagtcgaacaaaccgtattcgaccgtttactggtaggcatggcgagt
acctatcccgcgagcgtcagtggttatgtgactgactcagccgccgcggcaaccgcactc
gccactggggtaaaatcctataatggggcgatttcggtcgatacccaaaagcaaccactg
ccgaccatactcgaaaaagccaaatcccttggccttagcacaggggtcgcggtaacgtcg
caaatcaaccacgccacgccagccgcctttttggcccacaacgagagccgtaaaaactac
gacgctctggcactcagctatttagaaaccaacgccgatgtatttttaggcggtggtcaa
aagtattttcctcctgcgctgttagagcagttcaaagccaagggctatcaacacatcagc
cgttttgaggatctcgccagcatcacccaaccaaaagtgttgggcctgtttgccgaagta
caattgccctgggcgattgatgagaaagatgcaagaaaactcagcaccttaactcaaaaa
gcactcagcttactgtcgcaaaatgaccaaggttttgtgttgttagtcgaagggagtctc
atcgactgggcgggccacaataacgacatcgccacagccatgggtgagatggatgaattc
tccaatgccattgaagtggttgagcaatttgtgcgtgaacatcccgataccctgatggtg
atcaccgccgaccacaataccggtggtctatcgattggcgtcgatggcaattacagctgg
aaccctgaaatcctgcgtaatatctcggccagcacagacactttggccttagccgcaatc
actggtgagcaatggcaagccgatctcgcccgcggtttaggctttgaacttagcgaagaa
gaagtcgccaaattgaacgtcgccagaatgcagggattagaaaccatggcggtggcgatt
cgccatgttattgataaacgtactgatacaggttggacaaccgacggtcacacaggcaca
gacgtacaagtttttgccgcaggtccggcgtctgagctgtttaacggccatcaagataat
accgatatcgccaataagatttttagcttattacctaaaccgaagaaacctaaaagctaa

DBGET integrated database retrieval system