KEGG   Shewanella baltica BA175: Sbal175_0956Help
Entry
Sbal175_0956      CDS       T02014                                 

Definition
Phospholipase A(1) (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
sbb  Shewanella baltica BA175
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:sbb00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:sbb00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:sbb00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:sbb00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1148900..1149784)
Genome map
AA seq 294 aa AA seqDB search
MKRLYSGIAMAGLLACTSINAEESLVEGRVKDELATAELPFVITPHKVNYILPATYSPDP
NMAPFAEDALINPYTLDEFEAKFQISFKFPIWYNVFGDNGHLFFAYTNQSYWQVYNKDTS
SPFRETNHEPEVFMLFNNDWKIGSVTNSFWGVGAVHQSNGKSGPLSRSWNRLYATMIFDA
GPLAFSTKVWWRIPEDEKTDPHQARGDDNPNIDDYIGRAEFIGVYGIDEHRFTLTLKTNL
EDIDRGSAELTWSYPIVGNLRLYTQYFNGYGESLIDYNYHNQRIGIGISLNDIL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgactttattcaggtattgcaatggctgggctattagcttgtacgagtataaat
gccgaagaatcattagtagaaggaagagtcaaagatgaacttgccacggcagaactgcct
tttgtgattacaccacataaagtgaattacattttacctgcgacctatagcccagatccc
aacatggcaccgttcgctgaagatgccctcatcaatccctataccttggatgagttcgag
gctaagtttcaaatcagtttcaaattccctatttggtacaatgtctttggtgataatggt
catttattctttgcctataccaatcaatcctattggcaggtttataacaaagacacctca
tctccgttccgtgaaaccaatcacgagcctgaagtctttatgctgtttaataacgattgg
aaaatcggcagtgtgaccaattccttttggggcgttggtgctgtgcatcaatcgaatggt
aaatcaggaccgctttctcgcagctggaatcgactctatgccactatgatttttgatgcc
ggtccactcgccttctcaaccaaagtctggtggcgtattcctgaggatgaaaaaacagat
ccgcatcaagcccgcggtgacgataatcccaatattgatgactacataggcagagctgag
tttattggtgtgtatggtatcgatgaacatagattcaccttaacccttaaaacaaaccta
gaagatattgacagaggctcagcagaactgacctggagttatcctatcgtcggtaactta
cgcctttatactcaatactttaatggttatggcgagagcctaatcgattacaactatcac
aaccaacgtattggtatcgggatttcgctcaacgatattctgtag

DBGET integrated database retrieval system