KEGG   Shewanella baltica BA175: Sbal175_1140Help
Entry
Sbal175_1140      CDS       T02014                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
sbb  Shewanella baltica BA175
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Sbal175_1140
Enzymes [BR:sbb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Sbal175_1140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1355001..1356332
Genome map
AA seq 443 aa AA seqDB search
MFLAQEIIRKKRNGLALSSEEIQFFVQGITTNSVSEGQIAALGMAVYFNDMNMDERIALT
TAMRDSGTVLNWQSLGLNGPVIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHT
GGTLDKFDAIPGYQTEPSSELFRKVVKEVGVAIIGQTGDLVPADKRFYSIRDNTATVESI
SLITASILSKKLACNLDALAMDVKVGSGAFMPTYEASEELARSIAAVANGAGTKTTALLT
DMNQVLASCAGNAVEVKEAIDFLTGAYRNPRLYEVTMGLCAEMLLLGGLASNEADARAKL
NRVLDNGRAAELFGKMVSGLGGPVDFVENYSKYLPQSQIIRPVFADMQGYAYSMDTRELG
LAVVTLGGGRRKPGDALDYSVGLTQVCALGDKVDSSTPIAVIHAQSEAAFAEAELAVKKA
IHIGETAPEKTPEIYAYIRASDL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtttctagctcaagagattattcgtaaaaaacgtaatggtttagcgctaagttccgaa
gaaatacagttctttgttcaaggtatcaccaccaactccgtatctgaaggtcagatcgcc
gcattaggtatggcggtgtattttaatgacatgaatatggatgaaagaatcgctttaacg
acagcaatgcgtgattctggcactgtgcttaattggcaatcattgggactcaacggtcct
gtcatcgacaaacacagcactggtggtgtcggcgatgtgattagtctcatgctcggccct
atggctgcggcgtgtggcggttatgtgcctatgatttctgggcgcggcctaggtcatact
ggcggtacactcgataagtttgatgccattccgggttaccaaacagagccttcaagtgaa
ttgttccgcaaagtggtgaaagaagtcggggtggcgattattggccagacgggcgatctg
gttcccgctgataaacgcttctattctattcgcgataataccgccaccgttgaatccatt
tccctcatcacagcatcgatcctgtctaagaaattagcctgtaatttagatgcgttggcg
atggacgtgaaagtcggtagcggcgcttttatgccaacctatgaggcatcggaagaatta
gctcgcagtatcgccgccgttgcaaatggcgcgggtactaaaacgacggctttgcttacc
gatatgaatcaagtgcttgcatcttgtgcaggtaacgcggttgaagtgaaagaagccatc
gactttttaacgggtgcttaccgtaacccgcgtttatatgaagtcactatgggtctttgt
gctgagatgctgctccttggcggtcttgcaagcaatgaagccgatgctcgcgctaaactg
aatcgtgtactcgacaatggtcgcgctgcagaactctttggcaagatggtgtcgggtctt
ggtggtccggttgattttgttgaaaactacagtaaatacctgccgcagtcacaaattatt
cgtcccgtctttgccgatatgcaaggttatgcctatagcatggatacccgtgagttaggt
ttagcggttgtgaccttaggtggcggccgccgtaagcctggcgatgcactagactatagt
gttggcttaacccaagtgtgtgccctaggcgataaagtggattcatcgacgccgattgcc
gttatccatgcacaatctgaagccgccttcgcggaagcggaactcgcggtgaaaaaagcg
attcacattggtgaaaccgctccagaaaaaacacctgagatctatgcctatattcgtgca
tcggatctttaa

DBGET integrated database retrieval system