KEGG   Shewanella baltica BA175: Sbal175_1241Help
Entry
Sbal175_1241      CDS       T02014                                 

Definition
DNA polymerase III chi subunit HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
sbb  Shewanella baltica BA175
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Sbal175_1241
   00240 Pyrimidine metabolism
    Sbal175_1241
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Sbal175_1241
   03430 Mismatch repair
    Sbal175_1241
   03440 Homologous recombination
    Sbal175_1241
Enzymes [BR:sbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Sbal175_1241
DNA replication proteins [BR:sbb03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Sbal175_1241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1489740..1490237)
Genome map
AA seq 165 aa AA seqDB search
MTQVLFYLMPPVASTAKADSSVATVNANPALCEMHLLACQLAQQAFVKQQWVYIHCQDKQ
QAHAIDELLWQFEPSAFVPHNLKGEGPMTGSPVEIGFDRLGANKSRQVLINLADQAPPFA
VNFGHIIDFVANDDQHKAVARERYRQYRGLGVNLQTQDLATHPLN
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagtgctgttttatctcatgccgccagtggcatcaacggccaaggctgattca
tctgttgcaaccgtgaatgcgaaccctgcactttgcgagatgcatcttctggcatgccaa
ctggcgcagcaggcttttgtgaaacaacaatgggtctatatccattgccaagataagcag
caagcccatgcgattgatgaacttttatggcagtttgagccaagtgcctttgtacctcat
aacctcaaaggtgaaggcccgatgacgggatcgccggtagaaattggttttgatcgcctc
ggcgccaacaaaagtcgccaagttctgattaatcttgcagaccaagcgcccccatttgcg
gtaaactttggccacattatcgattttgttgccaatgacgatcagcataaagcggtcgct
cgcgaacgttatcgacagtatcgcggcttaggggtcaatttacagacccaagacttagca
acacatccacttaattag

DBGET integrated database retrieval system