KEGG   Shewanella baltica BA175: Sbal175_1323Help
Entry
Sbal175_1323      CDS       T02014                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sbb  Shewanella baltica BA175
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:sbb00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:sbb00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1575253..1575945
Genome map
AA seq 230 aa AA seqDB search
MGCFLLVSLDFRSAQSVLLHRYAVVNDSFYFLIQYDLYLVRLRNVPVKEKAMKKLPMIFA
MTASLMSVGAMAATCPEYLNLEVRKLHSEETVNLCELTQGKPVLIVNTASNCGYTPQFKA
LEALHENYKDKGLVVIGFPSDDFFQEENDEKDTAKVCYINYGVTFTMLSTSAVRGSDANS
VFKYLAEKTGAPKWNFYKYVVSGDGAVVQQFNSKVKPDSEELKQAIESVL
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgggctgctttttgttggtgtcgttagattttcgttcagctcaatcggttttacttcat
cgctatgcggtcgttaacgatagcttttattttttaattcaatatgatctttacctagta
cgtttgcgtaatgtaccggtaaaggagaaagcaatgaaaaaattacctatgatattcgct
atgacagcgagcttgatgagtgttggcgctatggcggccacttgtcccgagtatttgaac
cttgaagtacgaaaattacattctgaagagacagttaatctgtgtgaattgactcaggga
aagccagtgttgattgttaacactgcgagtaactgtggttataccccgcagtttaaagcg
ctcgaagcattgcatgaaaactataaagacaaaggcttagtggttattggtttcccatcg
gatgattttttccaagaagaaaatgatgagaaagacacggctaaggtgtgttacatcaat
tacggtgtcactttcactatgttgtcgacttcggctgtgcgtggcagtgacgccaatagc
gtatttaaatacttagccgagaaaaccggtgcgcctaagtggaatttctacaagtatgtc
gttagcggcgatggcgcggttgtgcaacagttcaattcaaaagtgaagccagatagcgaa
gagcttaagcaagcaatagaatctgtactttaa

DBGET integrated database retrieval system