KEGG   Shewanella baltica BA175: Sbal175_1642Help
Entry
Sbal175_1642      CDS       T02014                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sbb  Shewanella baltica BA175
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sbal175_1642
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sbal175_1642
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sbal175_1642
Enzymes [BR:sbb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sbal175_1642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1946671..1947507)
Genome map
AA seq 278 aa AA seqDB search
MSDTLTNPGLYQAARYQATFAKLKAEGRGAFVPFVTLGDPSPELSLKIIDTLVQNGADAL
ELGFPFSDPLADGPVIQGANLRSLAAGTTPTACFELLAQVRAKYPELPIGLLLYANLVFA
NGIDAFYAKAQQAGVDSVLIADVPVEESAPFSEAAKAHGIAPIFIAPPNADSETLALVSA
SGEGYTYLLSRAGVTGTDTKAGVPVEEILSKLKTFNAPPPLLGFGIAEPAQVSAAIKAGA
AGAISGSAVVKIIETHQHDETKLLAALGDFTRAMKAAT
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatacattgactaacccaggcctttaccaagcggcccgttaccaagccaccttt
gccaaactcaaagccgaaggccgtggtgcttttgtccccttcgtcactcttggtgatcct
agccctgagttatcgctgaaaattatcgataccttagtgcaaaacggtgccgatgcctta
gaactgggctttccgttttccgatcccttggccgatggccctgtgatccaaggtgctaac
ctgcgttctttagcggcgggcacgactccaacggcgtgttttgaattactggcgcaagtg
cgtgctaaatatcctgaactgccaatcggtttgctgctgtatgcgaacttagtttttgct
aatggcatagatgcgttttacgccaaagcgcagcaagcgggtgtggattcagtgcttatt
gccgacgtaccagtggaagaatcggcgccctttagcgaagcggctaaagcccatggtata
gcgccaatttttatcgcgccgcccaatgccgacagtgaaacccttgcactggttagcgcc
agcggtgaaggttacacctatctcttatcccgcgcaggggtgacaggcacagacactaaa
gctggcgttccggtggaagaaattctatccaagttgaaaacttttaacgcgccgccaccg
ctactcggctttggcattgccgaacccgctcaagtgagcgccgccatcaaagcaggcgct
gcaggggcgatttcaggctctgctgtcgtgaaaatcatcgaaacccaccagcacgatgaa
actaaactacttgcggcgcttggggattttactcgcgccatgaaggctgcaacctaa

DBGET integrated database retrieval system