KEGG   Shewanella baltica BA175: Sbal175_1643Help
Entry
Sbal175_1643      CDS       T02014                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sbb  Shewanella baltica BA175
Pathway
sbb00260  Glycine, serine and threonine metabolism
sbb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sbb01100  Metabolic pathways
sbb01110  Biosynthesis of secondary metabolites
sbb01130  Biosynthesis of antibiotics
sbb01230  Biosynthesis of amino acids
Module
sbb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sbal175_1643
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sbal175_1643
Enzymes [BR:sbb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sbal175_1643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEG10919
UniProt: G0AU89
Position
complement(1947513..1948703)
Genome map
AA seq 396 aa AA seqDB search
MSKLKLNPYFGEYGGMYVPQILVPALKQLETAFVEAQEDDDFKAEFTDLLKNYAGRPTAL
TLTRNLSPNPMVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVAT
ALACALLGLKCKVYMGAKDVARQSPNVFRMRLMGAEVIPVTSGSATLKDACNEAMRDWSG
SYDKAHYLLGTAAGPHPFPTIVREFQRIIGEETKKQMLEREGRLPDAVIACVGGGSNAIG
MFADFIDEPSVELIGVEPAGKGIDTPMHGAPLKHGKTGIFFGMKAPLMQDSEGQIEESYS
ISAGLDFPSVGPQHAHLNATGRARYESATDDEALEAFQQLARCEGIIPALESAHAIAYAV
KMARECTKETILVVNLSGRGDKDIFTVSDILNGKEV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagttaaagcttaacccttatttcggcgaatacggcggcatgtatgtgccacag
attttagtgccagcccttaagcaattagaaactgcctttgtggaagcgcaggaagatgac
gactttaaagccgaatttaccgatttactgaaaaactacgcgggtcgccctacagcactg
accttaacccgcaatttaagccccaatcctatggtaaaaatctacctcaaacgagaagat
ttactccacggcggcgcacataaaactaaccaagtgttaggccaagctctgctggctaaa
cgcatgggcaaaaaggaaatcattgctgaaactggcgcaggacaacacggcgttgccacc
gcccttgcctgcgcgctattaggcttaaaatgtaaagtctatatgggtgctaaagacgtt
gcgcgccaatcaccgaacgtatttagaatgcgtttgatgggcgcggaagtcattcctgtc
acctcaggttctgccaccctaaaagatgcctgtaacgaagcgatgcgcgactggtctggc
agctacgataaagcccactatttactcggcacagccgcggggccacatccattcccaaca
atcgtgcgtgagttccaacgcattattggcgaagaaaccaagaagcaaatgctggaacgc
gaaggtcgcctacccgatgcggttatcgcctgtgtgggcggcggttccaacgccatcggc
atgtttgctgactttatcgacgagccaagtgtcgaactgattggcgtcgaacctgcgggt
aaaggcatcgacacgccaatgcacggcgcgccgcttaaacacggtaagacaggtattttc
ttcggtatgaaagcgcctttgatgcaagatagcgaaggccaaatcgaagaatcctactca
atttcagctggattggacttcccatccgttggcccgcagcatgcgcatcttaatgccaca
ggccgcgcccgttatgaatcggctaccgacgatgaagcgctagaagccttccaacaactg
gctcgctgtgaagggattatccccgcattggaatcggcccatgctatcgcctatgcagtg
aaaatggcgcgcgagtgcactaaggaaaccattttagtggtcaatctttccggtcgtggc
gacaaagatattttcaccgtttctgacattttgaatggtaaagaggtataa

DBGET integrated database retrieval system