KEGG   Shewanella baltica BA175: Sbal175_1755Help
Entry
Sbal175_1755      CDS       T02014                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
sbb  Shewanella baltica BA175
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sbal175_1755
DNA repair and recombination proteins [BR:sbb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Sbal175_1755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2086324..2086923
Genome map
AA seq 199 aa AA seqDB search
MKFSPLLDELIQSLRCLPGVGPKSAQRMAFQLLERDRKAGLKLASALSSAMSDVGHCQSC
RTYTEETLCPICASHKRGTSSTICVVETPADVLAIEAGGHFTGRYFVLLGHLSPLDGVGP
EELGLALLERHLASGDVAELILATNPTVEGEATAHFIADMARRHKVMISRIAHGVPVGGE
LEYVDSTTLALSFNGRLPL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttagtccactgttagatgagttaattcagtccctgcgttgtttacctggggtt
gggcctaaatcggcgcaacgtatggcgtttcagttactcgagcgcgacagaaaagcaggg
cttaaattagccagtgcgctgtccagtgcgatgagtgacgtcggtcattgtcagtcttgc
cgaacctacactgaagaaaccctctgtccgatttgtgctagccataaacgcggcacgtct
tccaccatttgtgtggtggaaacgccggccgatgtgttagccattgaggcgggtggacat
ttcaccggtcgctactttgttcttttaggccatctatcgcccctcgatggtgttgggccg
gaagagctaggtttagcgttacttgagcgccacttggcctcgggtgatgtggccgagttg
attttagcgaccaatccgacggtagaaggcgaggcaacagcgcattttattgctgatatg
gccagacgccataaggtgatgatcagtcgcatcgcccacggcgtgcccgttggtggagag
cttgaatacgtcgatagcacgacgttagctttgtcatttaatggccgtttgccgctttaa

DBGET integrated database retrieval system