KEGG   Shewanella baltica BA175: Sbal175_1860Help
Entry
Sbal175_1860      CDS       T02014                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
sbb  Shewanella baltica BA175
Pathway
sbb00020  Citrate cycle (TCA cycle)
sbb00190  Oxidative phosphorylation
sbb00650  Butanoate metabolism
sbb01100  Metabolic pathways
sbb01110  Biosynthesis of secondary metabolites
sbb01120  Microbial metabolism in diverse environments
sbb01130  Biosynthesis of antibiotics
sbb01200  Carbon metabolism
Module
sbb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sbb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sbal175_1860
   00650 Butanoate metabolism
    Sbal175_1860
  Energy metabolism
   00190 Oxidative phosphorylation
    Sbal175_1860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: AEG11130
UniProt: G0AWT4
Position
2198106..2198453
Genome map
AA seq 115 aa AA seqDB search
MVTNAASFGRSGVHDYILLRASAVILACYTIFLVGFIACSSPLTYDVWHSLFSALPMKVF
TLLALVALLVHAWIGVWQVLTDYVKCTSLRGVLQFTFVVTVFCYLAAGIVIVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaatgcagcaagttttggacgcagtggtgttcatgactatattctactacgc
gctagtgcagtgatcctcgcctgttacaccattttcttggttggctttattgcatgtagt
tcccctctcacctacgacgtgtggcatagcctttttagcgctctgccgatgaaagtgttt
acacttctggcgctggtagcattattagtacacgcttggattggtgtatggcaagtgctg
acagattacgtcaagtgcacgtcgttacgtggtgttttacagttcacctttgtcgttacc
gtattttgttatttagcggccggcattgttattgtgtggggtgtctaa

DBGET integrated database retrieval system