KEGG   Shewanella baltica BA175: Sbal175_1860Help
Entry
Sbal175_1860      CDS       T02014                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
sbb  Shewanella baltica BA175
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sbal175_1860
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sbal175_1860
   00650 Butanoate metabolism
    Sbal175_1860
  Energy metabolism
   00190 Oxidative phosphorylation
    Sbal175_1860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2198106..2198453
Genome map
AA seq 115 aa AA seqDB search
MVTNAASFGRSGVHDYILLRASAVILACYTIFLVGFIACSSPLTYDVWHSLFSALPMKVF
TLLALVALLVHAWIGVWQVLTDYVKCTSLRGVLQFTFVVTVFCYLAAGIVIVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaatgcagcaagttttggacgcagtggtgttcatgactatattctactacgc
gctagtgcagtgatcctcgcctgttacaccattttcttggttggctttattgcatgtagt
tcccctctcacctacgacgtgtggcatagcctttttagcgctctgccgatgaaagtgttt
acacttctggcgctggtagcattattagtacacgcttggattggtgtatggcaagtgctg
acagattacgtcaagtgcacgtcgttacgtggtgttttacagttcacctttgtcgttacc
gtattttgttatttagcggccggcattgttattgtgtggggtgtctaa

DBGET integrated database retrieval system