KEGG   Shewanella baltica BA175: Sbal175_1864Help
Entry
Sbal175_1864      CDS       T02014                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sbb  Shewanella baltica BA175
Pathway
sbb00020  Citrate cycle (TCA cycle)
sbb00310  Lysine degradation
sbb01100  Metabolic pathways
sbb01110  Biosynthesis of secondary metabolites
sbb01120  Microbial metabolism in diverse environments
sbb01130  Biosynthesis of antibiotics
sbb01200  Carbon metabolism
Module
sbb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sbal175_1864
  Amino acid metabolism
   00310 Lysine degradation
    Sbal175_1864
Enzymes [BR:sbb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sbal175_1864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AEG11134
UniProt: G0AWT8
Position
2204017..2205207
Genome map
AA seq 396 aa AA seqDB search
MSIEIKVPVLPESVADATIATWHVKVGEQVSRDQNLVDIETDKVVLEVVAPEDGHIGEFL
FEEGATVLGEQVIAKFIAGAVSGKEVTKAQAEAATPAAETSDESSDALSPSVRRLLAEHN
VDASKVKGTGVGGRITKEDVEAFVKSAPKAAAPAAPAVAPLAAGRSEKRVPMTRLRKTIA
NRLLEAKNSTAMLTTFNEVNMKPIMDIRKQYQDIFEKRHGIRLGFMSFYIKAVTEALKRF
PEVNASIDGDDIVYHNYFDISIAVSTPRGLVTPVLRDTDTMNLAEIEKAVRDLALKGRDG
KLTVADMTGGNFTVTNGGVFGSLMSTPILNLPQSAILGMHAIKDRPMAVNGQVEILPMMY
LALSYDHRIVDGRESVGFLVAIKDFLEDPTRLLLDL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgaaatcaaggtacccgtactaccagaatctgttgccgatgccacgattgcc
acttggcatgtgaaagtgggcgagcaagtttctcgtgatcaaaacctggttgatattgaa
accgataaagtggttcttgaagtggttgcgccagaagatggccacattggcgagtttttg
tttgaagaaggcgccactgttctgggtgaacaagtgatcgctaaattcatcgccggtgct
gtatctggcaaagaagtcactaaagcgcaagctgaagcggcaacgcctgcagctgaaacc
agcgatgaaagcagtgatgcgttaagcccatctgttcgccgcttactggctgagcacaat
gttgatgccagcaaagtaaaaggcactggtgtgggtggtcgtattactaaagaagacgtt
gaagcttttgttaagtctgcgcctaaagctgcggcgccagcagcacctgctgtggctcca
ttagcggctggccgtagcgagaagcgcgtgccaatgacacgtctgcgtaagacaatcgct
aaccgcttgttagaagcgaaaaactctaccgctatgctcacgacgtttaacgaagtgaac
atgaagccaatcatggatatccgtaagcaataccaagatatctttgaaaagcgtcacggt
atccgtttaggctttatgtctttctacatcaaagctgtgactgaagcgctgaaacgtttc
ccagaagtcaacgcgtctattgatggcgatgatatcgtttatcacaactacttcgacatc
agcattgcagtatcaacgccacgtggtctggtaacaccagtgttacgtgacactgatacc
atgaacttagctgaaatcgaaaaagctgtccgtgacttagcccttaaaggccgtgacggt
aagctgactgtggctgacatgactggcggtaacttcactgtgactaacggtggcgttttc
ggttcattgatgtctacaccgattcttaacctgccacaaagcgcgattttaggcatgcat
gccattaaagatcgcccaatggcagtcaatggtcaggttgaaatcctgcccatgatgtac
ctggcactctcatatgaccatcgtattgttgatggccgtgagtctgttggtttcttggtg
gcgattaaagacttcctagaagacccaactcgtctgctgcttgatctgtaa

DBGET integrated database retrieval system