KEGG   Shewanella baltica BA175: Sbal175_1864Help
Entry
Sbal175_1864      CDS       T02014                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sbb  Shewanella baltica BA175
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:sbb01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sbb00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:sbb00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2204017..2205207
Genome map
AA seq 396 aa AA seqDB search
MSIEIKVPVLPESVADATIATWHVKVGEQVSRDQNLVDIETDKVVLEVVAPEDGHIGEFL
FEEGATVLGEQVIAKFIAGAVSGKEVTKAQAEAATPAAETSDESSDALSPSVRRLLAEHN
VDASKVKGTGVGGRITKEDVEAFVKSAPKAAAPAAPAVAPLAAGRSEKRVPMTRLRKTIA
NRLLEAKNSTAMLTTFNEVNMKPIMDIRKQYQDIFEKRHGIRLGFMSFYIKAVTEALKRF
PEVNASIDGDDIVYHNYFDISIAVSTPRGLVTPVLRDTDTMNLAEIEKAVRDLALKGRDG
KLTVADMTGGNFTVTNGGVFGSLMSTPILNLPQSAILGMHAIKDRPMAVNGQVEILPMMY
LALSYDHRIVDGRESVGFLVAIKDFLEDPTRLLLDL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgaaatcaaggtacccgtactaccagaatctgttgccgatgccacgattgcc
acttggcatgtgaaagtgggcgagcaagtttctcgtgatcaaaacctggttgatattgaa
accgataaagtggttcttgaagtggttgcgccagaagatggccacattggcgagtttttg
tttgaagaaggcgccactgttctgggtgaacaagtgatcgctaaattcatcgccggtgct
gtatctggcaaagaagtcactaaagcgcaagctgaagcggcaacgcctgcagctgaaacc
agcgatgaaagcagtgatgcgttaagcccatctgttcgccgcttactggctgagcacaat
gttgatgccagcaaagtaaaaggcactggtgtgggtggtcgtattactaaagaagacgtt
gaagcttttgttaagtctgcgcctaaagctgcggcgccagcagcacctgctgtggctcca
ttagcggctggccgtagcgagaagcgcgtgccaatgacacgtctgcgtaagacaatcgct
aaccgcttgttagaagcgaaaaactctaccgctatgctcacgacgtttaacgaagtgaac
atgaagccaatcatggatatccgtaagcaataccaagatatctttgaaaagcgtcacggt
atccgtttaggctttatgtctttctacatcaaagctgtgactgaagcgctgaaacgtttc
ccagaagtcaacgcgtctattgatggcgatgatatcgtttatcacaactacttcgacatc
agcattgcagtatcaacgccacgtggtctggtaacaccagtgttacgtgacactgatacc
atgaacttagctgaaatcgaaaaagctgtccgtgacttagcccttaaaggccgtgacggt
aagctgactgtggctgacatgactggcggtaacttcactgtgactaacggtggcgttttc
ggttcattgatgtctacaccgattcttaacctgccacaaagcgcgattttaggcatgcat
gccattaaagatcgcccaatggcagtcaatggtcaggttgaaatcctgcccatgatgtac
ctggcactctcatatgaccatcgtattgttgatggccgtgagtctgttggtttcttggtg
gcgattaaagacttcctagaagacccaactcgtctgctgcttgatctgtaa

DBGET integrated database retrieval system