KEGG   Shewanella baltica BA175: Sbal175_1865Help
Entry
Sbal175_1865      CDS       T02014                                 

Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sbb  Shewanella baltica BA175
Pathway
sbb00020  Citrate cycle (TCA cycle)
sbb00640  Propanoate metabolism
sbb00660  C5-Branched dibasic acid metabolism
sbb01100  Metabolic pathways
sbb01110  Biosynthesis of secondary metabolites
sbb01120  Microbial metabolism in diverse environments
sbb01130  Biosynthesis of antibiotics
sbb01200  Carbon metabolism
Module
sbb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sbal175_1865
   00640 Propanoate metabolism
    Sbal175_1865
   00660 C5-Branched dibasic acid metabolism
    Sbal175_1865
Enzymes [BR:sbb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Sbal175_1865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AEG11135
UniProt: G0AWT9
Position
2205313..2206479
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKSLFAEYGLPVSEGFACDTAQEAVEAAGHIGGNLWVVKCQVHAGGRGKAGGV
KVTGDKEEIRAFAEHWLGKNLVTYQTDEKGQPVAKILVESCTDIANELYLGAVVDRATRR
VVFMASTEGGVEIEKVAEETPELIHTAIIDPLTGPQGYQARDLGFKLGLNPTQMKQFTKI
FMGLATMFVDHDFALLEINPLVITTEGNLHCLDGKIGIDGNALYRQPKIKGMHDPSQDDA
REAHAAKFELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDSNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGTNAELGREV
LAKSGLDIIAATSLTDAAEQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgagtatcaggcaaaatccttatttgccgaatatggtttaccagtgtca
gaaggttttgcatgtgatacagcccaagaagctgtagaagcggcaggccatattggcgga
aatttatgggttgttaagtgtcaagtacacgctggcggccgcggtaaagcgggtggcgtt
aaagtcactggcgataaagaagaaatcagagcctttgccgaacactggttaggcaaaaat
ctggtgacttatcaaactgatgagaaaggtcagccagttgctaaaattttagtagaaagc
tgcaccgacatcgctaacgaactgtacctaggtgccgttgttgaccgcgcgactcgtcgc
gtagtgttcatggcgtcgactgaaggtggtgttgaaattgagaaagtggcagaagaaacg
ccagaactcatccacactgcaatcatcgatcctttgactggtccacaaggttatcaagca
cgtgatcttggtttcaagttaggtttaaacccaactcaaatgaagcagttcactaagatt
ttcatgggtctggcgactatgttcgttgatcatgatttcgcattgcttgaaatcaaccca
ctggttattactactgaaggcaacctacactgcctagacggtaaaatcggtatcgatggt
aacgcactttatcgtcaaccaaaaatcaaaggcatgcacgatccatcacaggatgatgcc
cgcgaagctcacgctgctaagttcgaactgaactacgtagcattagacggtaacgttggc
tgtatggtgaacggtgctggtctggctatggggactatggatatcgttaacttgcacggt
ggcaagccagcgaacttcctagacgtaggcggcggcgcgactaaagaacgtgtagcagaa
gctttcaaaatcattctgtctgacagcaatgtgaaagcggttctggttaacattttcggc
ggtatcgtacgttgtgacatgatcgcagaaggtattatcggcgctgttaaagaagtgggc
gttaaagtacctgttgtggttcgtttagaaggtactaacgctgaacttggccgtgaagta
ttagctaaatcaggtcttgatatcattgcagctaccagtctgactgacgcggctgagcaa
gttgttaaagctgcggagggcaaataa

DBGET integrated database retrieval system