KEGG   Shewanella baltica BA175: Sbal175_1952Help
Entry
Sbal175_1952      CDS       T02014                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
sbb  Shewanella baltica BA175
Pathway
sbb00340  Histidine metabolism
sbb01100  Metabolic pathways
sbb01110  Biosynthesis of secondary metabolites
sbb01230  Biosynthesis of amino acids
Module
sbb_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Sbal175_1952
Enzymes [BR:sbb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Sbal175_1952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEG11222
UniProt: G0AXJ5
Position
complement(2313147..2314448)
Genome map
AA seq 433 aa AA seqDB search
MEILTWSTLSTAEQKTALKRSPLIGDSGLEQSVRAILDAVATRGDAAIQEFNQKFDGFNS
AKIGELRMGEAEITAASARVSPELKAAISKAMANIDVFHSAQQFRPIDMETEAGVRCALR
SEPIEKVGLYIPGGSAPLISTVMMLALPAKIAGCEQRVLVSPPPINDAIIYAANACGITE
IYQVGGAQAIAALAFGTETIPAVDKIFGPGNRYVTEAKRLVSQDGRCTVCIDMPAGPSEV
LVIADSDANCEFIAADLLSQAEHGPDSQVILVTDSQAIADGVNDALTRQLAVLPRQDIAA
TALLSSRTFVVDDMLQAAQVSNQYGPEHLIIQTRFPREVLKNIRAAGSVFLGAYTPESVG
DYASGTNHVLPTYGYSRAVSSLSLADFSRRFTVQELSAKGLIGLGQAVMTLASNELLDAH
KNAIAVRLASLEK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcctaacttggtcaaccttatcaaccgccgagcagaaaacggcgctgaaacgc
tcgcccttaattggtgacagtggcttagagcaaagtgttcgcgccattctcgatgcggtg
gcgacgcggggtgatgccgccattcaagaatttaatcaaaaatttgatggcttcaatagc
gctaagattggcgagctgcgcatgggcgaagccgaaataactgcggcaagcgcacgggta
tcgccagagctgaaagcagcaatatccaaagccatggcgaacatagatgtgtttcacagc
gcccagcaatttcgcccaattgatatggaaaccgaggcgggagttcgctgcgcgttacgt
agcgaaccaattgaaaaagtcggtttatatatccccggtggcagtgcgccattaatttct
accgtgatgatgcttgccctgcccgccaagatcgccggctgcgaacaaagagtattggtc
agtccaccgccgatcaacgatgccattatctatgccgccaatgcctgcgggatcactgaa
atctatcaagtgggcggcgcgcaggccattgcggcactggcctttggcacggaaacgatt
ccggcggtcgataagatttttggcccaggtaatcgctatgtgacggaagctaaacgttta
gtgtcacaggatggtcgctgcactgtgtgtatcgatatgcccgctggcccttctgaggtg
ttggtgattgccgatagcgacgccaattgcgaattcattgccgccgatttgctttcacaa
gcggagcacggccctgattcacaagtgattttagtgacggattcgcaagctatcgccgat
ggcgtgaatgacgcattgacgagacaacttgccgtcctgccacgtcaagatatcgcggca
acggcgctactgagcagtcgcacttttgttgttgacgatatgctacaagccgcgcaggtt
tccaatcaatatgggcctgagcacttaatcattcaaacgcgctttccccgtgaggtgctg
aaaaacattcgcgccgctggctcagtgtttttaggcgcttatacgccggaatcagttggc
gattatgccagtggcaccaaccacgtgctgccgacttacggttacagccgcgccgtatcg
agcctgtcattagccgactttagccgccgctttaccgtgcaggaactcagcgctaaaggc
ttaattggactggggcaagcggtcatgacgttagccagtaacgaattgctcgatgcacac
aaaaatgccatcgcagtacgtttagctagcctagagaaatga

DBGET integrated database retrieval system