KEGG   Shewanella baltica BA175: Sbal175_2104Help
Entry
Sbal175_2104      CDS       T02014                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sbb  Shewanella baltica BA175
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sbal175_2104
Enzymes [BR:sbb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Sbal175_2104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2490141..2490758
Genome map
AA seq 205 aa AA seqDB search
MIGRLRGVLVEKQAPEILIDVNGVGYELQMPLTSFYELPEVNHETMVYTHFVVREDAQLL
YGFITKQERALFRLLIKTNGVGPKLALTILSGMTAGEFVGCVERDDIVTLVKLPGVGKKT
AERLLVEMRDKLKSLMEASAGSEREFVLQSNYSPAPTVNSAEEDAISALISLGYKPPQAS
KSVSAAYKEGMDSETLIKAALKSML
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgataggtcgtttaaggggcgtgttagttgagaaacaagcgccagaaattttgatcgat
gttaatggtgtgggttacgagttgcagatgccgctcaccagcttttatgagttgcctgaa
gttaaccatgaaactatggtctacacccactttgtggtgcgtgaagatgcacagttactc
tatggttttatcactaaacaggaaagggcgttatttcgcttactgatcaagaccaacggt
gtcggtcccaagctcgcactgaccattttatcaggtatgactgccggagagtttgtgggc
tgtgttgagcgtgatgacatagtgaccttagtgaaattacccggtgtgggtaagaagacc
gccgagcgtttactggtagaaatgcgcgataagctcaagagcttgatggaagcctcagca
ggttcagagcgtgagtttgtgctgcaatctaattactctcctgcgccgacagtcaatagt
gccgaagaagatgctatttcagctttgatttcgctgggttataaaccaccgcaggcgagt
aaatcagtttctgccgcttataaagagggcatggattcagaaactctgatcaaagctgcc
cttaagtcgatgctttaa

DBGET integrated database retrieval system