KEGG   Shewanella baltica BA175: Sbal175_2154Help
Entry
Sbal175_2154      CDS       T02014                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
sbb  Shewanella baltica BA175
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2553571..2554599
Genome map
AA seq 342 aa AA seqDB search
MPSTAENKELDSAAQILRLAVPQMSALDIPVTPENYTVWYEYFAGTNLDLNRAIDGFLAN
SVSFTKEVNTSLYKNFIQEQSPEVIENVQIETQILINSLLSKISQLSQGTAAFSGSLAEF
GLRLQTNPDINTLNELVDGVVDEMQMLLINNREMEQSLCTMGQEVQNLKSEMENLSLAAM
TDQLTSLHNRRAYELSIQDQIYLSQDHQTRCSLLLIDIDNFKAFNDTYGHLTGDKVLAYV
ALALKQCVRGDDFVARYGGEEFVVVLPNTHFHDALQVAENLRERISERRLTIGKDKKLSL
GAITVSIGLASLQQGDDAETLFSRADKALYQAKAEGRNCVRG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgccttctactgcagaaaataaagagcttgattctgccgcgcaaattttgcgtttggcc
gtaccgcaaatgtctgccctcgatatccccgttacacctgaaaactacactgtttggtat
gaatattttgcagggacaaatctcgatttaaatcgtgcgattgatggctttctggctaat
tcggtctcttttactaaggaggtcaataccagcctgtataagaacttcattcaagaacag
tcacccgaagtgattgaaaatgtgcagattgaaacgcaaatcctgatcaatagtttgtta
agtaaaatcagccagttgagtcaaggcactgcggcgttttcaggttcattagccgagttt
ggtttacgcctacagacgaatcccgacattaataccttaaacgagctggttgacggtgtg
gttgatgaaatgcagatgctactcatcaacaaccgtgagatggagcaaagcctgtgcacc
atgggccaagaagtgcaaaatcttaaatcggaaatggaaaacctgagcctggcagcgatg
actgaccaattaacctcgctgcacaatcgccgtgcctatgagttaagtattcaagatcaa
atctacctatcccaagatcaccaaacccgctgcagtcttttgctgatcgatatcgataat
tttaaagcctttaacgacacctatggccatttgaccggcgataaagtgttggcctatgtc
gcattagccttaaaacaatgtgtgcgaggggatgactttgtggcgcgctatggcggcgaa
gaattcgtggtggtcttacctaatacccattttcacgatgcattacaagtggctgagaat
ttgcgggaacgtatttctgagcgccgcttaaccataggaaaagacaaaaaactttctctt
ggcgcgattactgtttctattggtctggcttcattgcagcaaggcgacgatgcagaaacc
ctattcagtcgcgccgacaaagcgctgtatcaagctaaggccgaaggtcgtaactgcgtg
agaggataa

  All links  
No link information was found.   
DBGET integrated database retrieval system