KEGG   Shewanella baltica BA175: Sbal175_2330Help
Entry
Sbal175_2330      CDS       T02014                                 

Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sbb  Shewanella baltica BA175
Pathway
sbb03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sbal175_2330
Enzymes [BR:sbb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Sbal175_2330
DNA repair and recombination proteins [BR:sbb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Sbal175_2330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 Viral_helicase1 UvrD_C_2 Helicase_RecD AAA_11 AAA_22 UvrD-helicase DUF2075 UvrD_C AAA_28 PhoH PIF1 SRP54 AAA_16 NTPase_1 T2SSE ResIII Flavi_DEAD CobN-Mg_chel NACHT
Motif
Other DBs
NCBI-ProteinID: AEG11583
UniProt: G0B0Q1
Position
2756074..2758287
Genome map
AA seq 737 aa AA seqDB search
MMRSTQGLNAHSLTAAKWIDHGEIQLSAPLPELFKLWEQERLLTPLDRHFALEMSHLHPS
DSQQPLFILLCALLSQQLSSQHSCLVLAHIVPLNPMAEQNSHCKITLSLEALTETLQTFD
AVGQAGSNKPLIFDNGRLYLQRYYQFETSVAAALIRLSGSVSRQLSEEANNQEQPQIAKL
RSLLDQLFPANVLAPHALTTNVLTKSEDTAPIDWQKVATATALGKKLSVITGGPGTGKTT
TVTKLLLLLQMESQQEIRLVAPTGKAAARLSESIKASKARLAKELSAHTDVVDEARNRHS
QDFLTALGRIPEEASTLHRLLGVIPNSPHFRHHQGNPLRLDLLIVDEASMVDLPMMYKLL
SALPEHASLILLGDQDQLASVEAGAVLADICAGLKMPVAPNNLAQNNIASNSQALWQMRY
SKEQAERLSALTGFELTLFINDAPKLGDSLCMLMHSHRFKGDAGIGLLASAVNRADLQGI
LQVWQQGPAELKWLEHSMVVSQTQAKVSEPANNLGLNLLLEQACQQYGAYLRALNSHASN
NDVNNSDVGTRPSTADIIDSFNQYRILCAMRSGDYGVEGINQFVTQALANAKLIKPLQEF
YLGRPIIIQSNDYNLGLFNGDIGLILQDEDKPERLMAHFIKADGSLLKVLPARLPSHETC
YAMTVHKSQGSEFSRVALVLPPSPSLAQWQLLTKELVYTAITRAKVHFTCLGTQHVFERA
SSQATQRASGLADRLWG
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgctctactcaagggctaaacgcacattcactcacagccgcgaaatggatagac
catggcgaaatccagcttagcgcgccgctaccagagctgtttaaactgtgggagcaggaa
cgactgctcacaccgctcgatcggcatttcgcactcgagatgagccacttgcatccaagc
gacagccaacaacccttgtttattttgctatgtgcgctgttgagccagcaattatcttca
cagcacagctgcctagtgctcgcccatatcgtgccgcttaatcccatggccgagcaaaat
agccattgtaaaatcaccttaagcctagaagcgctcacagagactttgcaaacctttgat
gccgtcggccaagcaggaagcaacaaaccacttatttttgataatggcagactctatcta
caacgttattatcaatttgaaacctcagtggccgctgctttaattcgcttgtccggaagc
gtatctaggcaattatctgaagaagcaaacaaccaagagcaaccgcaaatcgctaagttg
aggtcactgctagatcaactgttccctgccaatgtgctcgcgccccatgcactcactacc
aatgtactcactaaaagtgaagacacagcacccattgattggcaaaaggtcgccaccgcc
acagcgctgggtaaaaaactgtcggtgatcactggcggcccaggtacgggcaaaaccacc
actgtaactaaacttttgttattgctacaaatggaatcacaacaggaaatccgtttagtc
gcgccaacgggaaaagcggcggctcgattaagcgaatcgatcaaagcttcaaaagcgcgt
ctagcgaaggaactcagcgcccatactgatgttgttgatgaagctcgcaatagacatagc
caagattttttaacggcactggggcgcattccagaggaagcatcaaccttacacagactg
cttggggtgatccccaattcgccgcactttcgccaccatcaaggtaatccgcttaggctc
gacttattgatcgtcgatgaagcctctatggtcgatttgcccatgatgtataaattgctc
agcgccttgcccgagcacgccagtttgattttacttggcgatcaggaccaactcgcctcg
gttgaggctggcgctgtgctcgccgatatttgtgctggcctgaaaatgccagtagctccc
aataacctcgcgcaaaataacatagcgtcaaacagccaagctctgtggcaaatgcgctat
tccaaggagcaagccgagcgcctgagcgctttaacgggttttgagttaacgctctttatc
aacgatgcccctaaacttggcgatagcttatgtatgctgatgcacagccacagatttaaa
ggcgatgcggggattggactgcttgctagcgccgtcaatcgcgcggatcttcaaggcata
ttgcaggtatggcaacaaggccctgctgaattgaagtggttagaacacagcatggtcgta
agccaaacccaagccaaagtgagcgagccggctaataatctgggactcaatttactgcta
gagcaagcctgccaacaatatggcgcctatctcagagccttgaatagccatgcaagtaac
aatgatgtaaataatagtgatgtaggcacacgtccaagcacggctgacatcatagatagc
tttaaccagtaccgcattctatgcgccatgcgctcgggcgattatggggtcgaaggcatc
aatcaatttgtgactcaagcactggccaatgccaagctgattaaaccgctgcaggagttt
tatctgggtcggccgattatcatccaaagcaatgactataacttaggcctgtttaacggt
gatatcggattgattttgcaggatgaagataaacccgaacgcttaatggcgcactttatc
aaggccgatggcagcctgttaaaagtcttgccagcacgtttacctagccatgaaacctgt
tacgccatgacagtacacaaaagccaaggcagtgagttcagccgtgtggccttagtactg
ccaccgagccccagcctagcgcagtggcaactgctgaccaaagagttggtctacaccgcc
attacccgcgctaaagtgcactttacctgcttaggcacccagcacgtattcgagcgggcc
agtagccaagcaacccaacgcgcatcgggtcttgcagacaggctttggggttaa

DBGET integrated database retrieval system